Nanorana parkeri (Xizang Plateau frog): 108797418 Help Entry 108797418         CDS       T04897                                  Name (RefSeq) ADP-ribosylation factor 1-like   KO K07937   ADP-ribosylation factor 1/2 Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04144   Endocytosis npr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108797418  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108797418  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npr04131]     108797418   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npr04147]     108797418    04031 GTP-binding proteins [BR:npr04031]     108797418 Membrane trafficking [BR:npr04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     108797418   Arf GTPases and associated proteins    Arf GTPases     108797418  Endosome - Golgi transport     108797418 Exosome [BR:npr04147]  Exosomal proteins   Proteins found in most exosomes    108797418 GTP-binding proteins [BR:npr04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     108797418 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha SRPRB Ras Gtr1_RagA MMR_HSR1 6PF2K FLAD1_M AAA_33 Yop-YscD_ppl_3rd RXYLT1_N Motif Other DBs NCBI-GeneID:  108797418 NCBI-ProteinID:  XP_018424506 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MGNMFATLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAV LLVFANKQVI NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atggggaacatgtttgcaactctgtttaagggcctctttggcaagaaggagatgaggata cttatggtgggcttggatgcagctggaaagaccaccatcctgtataagttgaagttgggc gagatagtgaccaccattcctaccataggttttaatgtggagactgtagaatacaagaac atcagcttcactgtctgggatgttggcggtcaggacaaaatccggcctctgtggcgtcac tatttccagaacactcagggtctcatctttgtggtggatagtaatgatagagagagagtt aacgaagccagagaggagttaacaaggatgttggcagaagatgagctgcgagacgctgta cttctggtgtttgcaaacaagcaggtaatttag

DBGET integrated database retrieval system