Nanorana parkeri (Xizang Plateau frog): 108799544 Help Entry 108799544         CDS       T04897                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04010   MAPK signaling pathway npr04012   ErbB signaling pathway npr04068   FoxO signaling pathway npr04137   Mitophagy - animal npr04140   Autophagy - animal npr04150   mTOR signaling pathway npr04210   Apoptosis npr04218   Cellular senescence npr04370   VEGF signaling pathway npr04371   Apelin signaling pathway npr04540   Gap junction npr04625   C-type lectin receptor signaling pathway npr04810   Regulation of actin cytoskeleton npr04910   Insulin signaling pathway npr04912   GnRH signaling pathway npr04916   Melanogenesis Brite KEGG Orthology (KO) [BR:npr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108799544 (NRAS)    04012 ErbB signaling pathway     108799544 (NRAS)    04370 VEGF signaling pathway     108799544 (NRAS)    04371 Apelin signaling pathway     108799544 (NRAS)    04068 FoxO signaling pathway     108799544 (NRAS)    04150 mTOR signaling pathway     108799544 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108799544 (NRAS)    04137 Mitophagy - animal     108799544 (NRAS)   09143 Cell growth and death    04210 Apoptosis     108799544 (NRAS)    04218 Cellular senescence     108799544 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     108799544 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108799544 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108799544 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     108799544 (NRAS)    04912 GnRH signaling pathway     108799544 (NRAS)    04916 Melanogenesis     108799544 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npr04131]     108799544 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npr04147]     108799544 (NRAS)    04031 GTP-binding proteins [BR:npr04031]     108799544 (NRAS) Membrane trafficking [BR:npr04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     108799544 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     108799544 (NRAS) Exosome [BR:npr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108799544 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    108799544 (NRAS)   Exosomal proteins of breast cancer cells    108799544 (NRAS)   Exosomal proteins of colorectal cancer cells    108799544 (NRAS) GTP-binding proteins [BR:npr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108799544 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  108799544 NCBI-ProteinID:  XP_018426916 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINSYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIHQYRMKKLDSNEDSSQG CIRLPCSLM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatacaaactggtggtggtgggagctgggggtgttggaaaaagtgccttaaca atacagcttatacagaaccattttgtagatgaatacgatcctacaattgaggactcttac agaaaacaggtggtgattgacggagaaacatgcttgctggatattttggatactgcaggc caagaggagtacagtgccatgcgtgaccagtatatgcgaactggtgaagggttcctttgt gtgtttgctatcaacaacagcaagtcctttgccgacatcaattcctatagggaacaaata aagagagtaaaagactcagatgatgtccctatggtacttgttggtaacaaatgtgattta ccaaccaggactgtagacaccaagcaagctcaggagctggccaggagttatggtatcccc ttcattgagacctctgcaaaaacaagacagggtgttgaagatgctttttatacactggtc cgtgaaatccatcagtacaggatgaaaaaactggacagcaatgaagacagcagccagggc tgtatccggttgccctgctctctcatgtaa

DBGET integrated database retrieval system