Nanorana parkeri (Xizang Plateau frog): 108803002 Help Entry 108803002         CDS       T04897                                  Name (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04010   MAPK signaling pathway npr04012   ErbB signaling pathway npr04068   FoxO signaling pathway npr04137   Mitophagy - animal npr04140   Autophagy - animal npr04150   mTOR signaling pathway npr04210   Apoptosis npr04218   Cellular senescence npr04370   VEGF signaling pathway npr04371   Apelin signaling pathway npr04540   Gap junction npr04625   C-type lectin receptor signaling pathway npr04810   Regulation of actin cytoskeleton npr04910   Insulin signaling pathway npr04912   GnRH signaling pathway npr04914   Progesterone-mediated oocyte maturation npr04916   Melanogenesis Brite KEGG Orthology (KO) [BR:npr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108803002    04012 ErbB signaling pathway     108803002    04370 VEGF signaling pathway     108803002    04371 Apelin signaling pathway     108803002    04068 FoxO signaling pathway     108803002    04150 mTOR signaling pathway     108803002  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108803002    04137 Mitophagy - animal     108803002   09143 Cell growth and death    04210 Apoptosis     108803002    04218 Cellular senescence     108803002   09144 Cellular community - eukaryotes    04540 Gap junction     108803002   09142 Cell motility    04810 Regulation of actin cytoskeleton     108803002  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108803002   09152 Endocrine system    04910 Insulin signaling pathway     108803002    04912 GnRH signaling pathway     108803002    04914 Progesterone-mediated oocyte maturation     108803002    04916 Melanogenesis     108803002  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npr04131]     108803002   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:npr04031]     108803002 Membrane trafficking [BR:npr04131]  Endocytosis   Macropinocytosis    Ras GTPases     108803002 GTP-binding proteins [BR:npr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108803002 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin G1_gp67_C ParA Motif Other DBs NCBI-GeneID:  108803002 NCBI-ProteinID:  XP_018430355 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHHYREQINRVKDSDDVPMVLVGNKCDL PSRTVDTKQAQELAKNYGIPFIETSAKTRQGVEDAFYTLVREIRKHKEKINNGKKKKSSR RKCVIL NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaagcttgtcgtggttggtgctggaggtgtgggcaagagcgctctgacc attcaactgatccaaaaccactttgttgatgagtatgatcccactattgaggattcatac cgaaagcaggttgtgatagatggtgaaacatgtctgctggatattcttgacactgccggt caagaggagtacagtgccatgcgggatcagtacatgcgaactggagaaggctttctgtgt gtctttgctattaataacacaaagtcctttgaggacgtccaccattacagagaacagatc aaccgagtaaaagactctgatgatgtccctatggtattagtcggtaacaaatgtgacctc ccatcacgaacagtggacacaaaacaagcacaagagttagcaaagaattatgggattccg ttcatagaaacctctgctaaaacgagacagggagttgaagatgcattctacaccctcgtc cgtgaaatccgcaaacacaaagagaagatcaacaatggaaagaagaagaaatcctccaga aggaagtgtgtcattctttaa

DBGET integrated database retrieval system