Nanorana parkeri (Xizang Plateau frog): 108803565 Help Entry 108803565         CDS       T04897                                  Name (RefSeq) histone H2A type 1   KO K11251   histone H2A Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr03082   ATP-dependent chromatin remodeling npr04217   Necroptosis Brite KEGG Orthology (KO) [BR:npr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     108803565  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108803565  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:npr03036]     108803565   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npr04147]     108803565 Chromosome and associated proteins [BR:npr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108803565 Exosome [BR:npr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108803565 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  108803565 NCBI-ProteinID:  XP_018430898 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKASKAK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaaacaaggcgggaagactcgtgctaaggcaaagacccgatcatcc cgggctggtctgcagttcccagtcggtcgtgttcaccgtctgctcaggaaaggaaactac gcccagcgggtcggtgccggagctcccgtctacctggccgccgttctggagtatctgacc gctgagatcctcgagctggccggtaacgccgcccgggacaacaagaagacccgcatcatc ccccgacacctccagctggctgtccgcaacgacgaggagctcaacaagctgctcggtggg gtcaccatcgcccagggaggagtcctgcccaacatccaggccgtgctgctgcccaagaag accgaaagtcacaaagcctccaaggccaagtaa

DBGET integrated database retrieval system