Nanorana parkeri (Xizang Plateau frog): 108804514 Help Entry 108804514         CDS       T04897                                  Symbol CALM2 Name (RefSeq) calmodulin   KO K02183   calmodulin Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04020   Calcium signaling pathway npr04070   Phosphatidylinositol signaling system npr04114   Oocyte meiosis npr04218   Cellular senescence npr04261   Adrenergic signaling in cardiomyocytes npr04270   Vascular smooth muscle contraction npr04371   Apelin signaling pathway npr04625   C-type lectin receptor signaling pathway npr04744   Phototransduction npr04910   Insulin signaling pathway npr04912   GnRH signaling pathway npr04916   Melanogenesis Brite KEGG Orthology (KO) [BR:npr00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     108804514 (CALM2)    04020 Calcium signaling pathway     108804514 (CALM2)    04070 Phosphatidylinositol signaling system     108804514 (CALM2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108804514 (CALM2)    04218 Cellular senescence     108804514 (CALM2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108804514 (CALM2)   09152 Endocrine system    04910 Insulin signaling pathway     108804514 (CALM2)    04912 GnRH signaling pathway     108804514 (CALM2)    04916 Melanogenesis     108804514 (CALM2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108804514 (CALM2)    04270 Vascular smooth muscle contraction     108804514 (CALM2)   09157 Sensory system    04744 Phototransduction     108804514 (CALM2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:npr01009]     108804514 (CALM2)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npr04131]     108804514 (CALM2)    03036 Chromosome and associated proteins [BR:npr03036]     108804514 (CALM2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npr04147]     108804514 (CALM2) Protein phosphatases and associated proteins [BR:npr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108804514 (CALM2) Membrane trafficking [BR:npr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     108804514 (CALM2) Chromosome and associated proteins [BR:npr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      108804514 (CALM2) Exosome [BR:npr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108804514 (CALM2) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 SAPC2_N UPF0154 Dockerin_1 EFhand_Ca_insen EF-hand_EFHB_C BamM_C Caleosin FCaBP_EF-hand DUF5580_M DUF1103 TerB SPEF2_C PA_Ig-like SurA_N_3 Motif Other DBs NCBI-GeneID:  108804514 NCBI-ProteinID:  XP_018431802 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKIKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgatcaactgacagaggagcagatcgcagaattcaaagaagccttctcactattt gataaggatggtgatggcacaattacaacaaaggagctgggtacagtgatgaggtcgctt ggccagaaccctacagaggcagagctgcaagatatgatcaatgaagtagatgcagatggt aatggaacaattgacttccctgaattcttgactatgatggctagaaaaattaaagacaca gacagtgaagaagaaattagagaagcattccgtgtgtttgacaaggacggtaatggctac attagtgctgctgagctccgtcatgttatgacaaatcttggtgagaagttaacagatgaa gaggttgatgaaatgatcagggaagcagatattgatggagatggtcaagtaaattacgaa gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system