Neodiprion pinetum (white pine sawfly): 124211024 Help Entry 124211024         CDS       T08966                                  Symbol ubl Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism npt  Neodiprion pinetum (white pine sawfly) Brite KEGG Orthology (KO) [BR:npt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:npt03041]     124211024 (ubl)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npt04052]     124211024 (ubl) Spliceosome [BR:npt03041]  Complex B   Other components    Complex B specific factors     124211024 (ubl) Cytokines and neuropeptides [BR:npt04052]  Neuropeptides   Unclassified    124211024 (ubl) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler OTU1_UBXL Motif Other DBs NCBI-GeneID:  124211024 NCBI-ProteinID:  XP_046465608 LinkDB All DBs Position 2:complement(24601652..24603918) Genome browser AA seq 73 aa AA seqDB search MLEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTHWEKIVLKKWYTIFKDHIKLQDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcttgagatcacttgcaatgaccgtcttggaaaaaaagtaagagtgaaatgtaatccc gatgacacgataggagatctaaaaaagctgatagcggcgcaaacgggaacccattgggaa aaaatagtcttaaaaaaatggtacaccatattcaaagaccacattaagctccaagactat gaaatacacgatggtatgaatttggagttgtattaccagtga

DBGET integrated database retrieval system