Neodiprion pinetum (white pine sawfly): 124213610 Help Entry 124213610         CDS       T08966                                  Symbol Rac1 Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism npt  Neodiprion pinetum (white pine sawfly) Pathway npt04013   MAPK signaling pathway - fly npt04145   Phagosome npt04148   Efferocytosis npt04310   Wnt signaling pathway npt04620   Toll-like receptor signaling pathway npt05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:npt00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     124213610 (Rac1)    04310 Wnt signaling pathway     124213610 (Rac1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124213610 (Rac1)    04148 Efferocytosis     124213610 (Rac1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124213610 (Rac1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124213610 (Rac1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npt04131]     124213610 (Rac1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npt04147]     124213610 (Rac1)    04031 GTP-binding proteins [BR:npt04031]     124213610 (Rac1) Membrane trafficking [BR:npt04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124213610 (Rac1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124213610 (Rac1)   Macropinocytosis    Ras GTPases     124213610 (Rac1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124213610 (Rac1) Exosome [BR:npt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124213610 (Rac1)   Exosomal proteins of other body fluids (saliva and urine)    124213610 (Rac1)   Exosomal proteins of colorectal cancer cells    124213610 (Rac1)   Exosomal proteins of bladder cancer cells    124213610 (Rac1) GTP-binding proteins [BR:npt04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124213610 (Rac1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  124213610 NCBI-ProteinID:  XP_046471022 LinkDB All DBs Position 3:17274203..17282573 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPTTPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPP IHPKPRRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgatcaagtgtgttgtggtcggcgacggggccgtgggtaaaacgtgcttgctg attagctacacaacaaatgcatttcctggtgaatatatcccaacggtattcgacaactat tctgcaaacgtcatggtggatggtaaaccgataaatctgggcctttgggatacggctggt caagaggattacgataggctcaggccactttcctacccacagaccgatgtctttttgata tgcttctcgctggtaaatcctgctagttttgaaaatgtgagagccaaatggtatcctgaa gtccgtcatcattgcccgaccactccaatcatcttagttggtaccaaacttgacttacgc gaagacaaggaaaccatcgaacgactcaaggacaaaaagctggcaccaatcacttaccct cagggtttagcaatggctaaggaaattggagctgtcaagtacctagagtgttcagccctg acgcagaaaggcttgaagactgtgtttgatgaagcgatacgtgccgttctctgtccacct atccatcccaagccaagacgcagatgttttctgctataa

DBGET integrated database retrieval system