Neodiprion pinetum (white pine sawfly): 124215352 Help Entry 124215352         CDS       T08966                                  Symbol Rab7 Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism npt  Neodiprion pinetum (white pine sawfly) Pathway npt04137   Mitophagy - animal npt04140   Autophagy - animal npt04144   Endocytosis npt04145   Phagosome npt04148   Efferocytosis Brite KEGG Orthology (KO) [BR:npt00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124215352 (Rab7)    04145 Phagosome     124215352 (Rab7)    04140 Autophagy - animal     124215352 (Rab7)    04137 Mitophagy - animal     124215352 (Rab7)    04148 Efferocytosis     124215352 (Rab7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npt04131]     124215352 (Rab7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npt04147]     124215352 (Rab7)    04031 GTP-binding proteins [BR:npt04031]     124215352 (Rab7) Membrane trafficking [BR:npt04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     124215352 (Rab7) Exosome [BR:npt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124215352 (Rab7)   Exosomal proteins of other body fluids (saliva and urine)    124215352 (Rab7)   Exosomal proteins of colorectal cancer cells    124215352 (Rab7)   Exosomal proteins of bladder cancer cells    124215352 (Rab7) GTP-binding proteins [BR:npt04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     124215352 (Rab7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 nSTAND3 PduV-EutP AAA_16 NTPase_1 AAA_5 AAA_7 Septin AAA_24 AAA_22 G-alpha ATPase_2 DAP3 SRPRB NACHT NB-ARC AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  124215352 NCBI-ProteinID:  XP_046474616 LinkDB All DBs Position 3:7671453..7679618 Genome browser AA seq 207 aa AA seqDB search MASRKKTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDGRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVAAPNTFKSLDSWRDEFLIQASPTDPDNFPF VVLGNKVDLETKAVAGKRAQQWCESKNNIPYFETSAKEAINVEQAFQTIAKNALAQENEV ELYNEFPPQIRLTDDTKNNGKGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgcgcaagaaaacgcttctgaaagtgatcatcctcggtgattccggagtggga aagacctcgttaatgaatcagtacgttaataaaaagttcagtaaccagtacaaggctacg attggcgctgactttctcaccaaggaagttatggtcgatggcaggatagtcacgatgcag atctgggacacggctgggcaggaaaggtttcaatccttgggtgtagctttttacagaggc gccgactgttgtgttttggttttcgacgttgctgcgccgaacaccttcaagtccctagac tcatggagagacgaattcctcattcaagcgtcgcccacagatccggacaactttccattc gttgttctgggcaacaaagtcgacctcgagactaaggccgtggcgggaaaacgagctcaa cagtggtgtgagtctaagaacaatattccatactttgagacgagtgctaaggaggcgata aacgtcgagcaagcctttcaaacgatagccaaaaatgcgctagctcaagaaaacgaggtg gaattgtacaacgagttcccaccccaaataagattaaccgacgatacaaaaaacaatggg aaaggagattcgtgtgcctgctag

DBGET integrated database retrieval system