Neodiprion pinetum (white pine sawfly): 124222379 Help Entry 124222379         CDS       T08966                                  Symbol EloB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism npt  Neodiprion pinetum (white pine sawfly) Pathway npt04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:npt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124222379 (EloB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:npt04121]     124222379 (EloB)    03400 DNA repair and recombination proteins [BR:npt03400]     124222379 (EloB) Ubiquitin system [BR:npt04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      124222379 (EloB)    Cul5 complex      124222379 (EloB) DNA repair and recombination proteins [BR:npt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124222379 (EloB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  124222379 NCBI-ProteinID:  XP_046489212 LinkDB All DBs Position 1:4804047..4806616 Genome browser AA seq 117 aa AA seqDB search MDVFLMIRRKKTTIFTDAKDNTTVLELKKIIEGILKIAPANQQLYSKDNVIMSDNKFLSD YGMTSAVAKAQCPALVALALRQEGGQFEPLEMTPYSLPPDLPDVMKSQEANGKEQTP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggacgtattcctcatgatcaggcgaaagaaaacgacgattttcacagacgctaaagac aacactaccgttcttgaattaaaaaagatcatagaaggtatactgaagattgctccggcg aatcaacaactctacagcaaagacaatgtcatcatgtccgataacaaatttttgtcggat tacggaatgacgtcggcagtggcaaaagcacaatgccctgctctggttgctttagcccta cgccaagaagggggtcagtttgaacctcttgaaatgacaccttactcgttaccacctgat ctccctgatgtaatgaaatcccaggaagccaacggcaaagaacaaactccgtga

DBGET integrated database retrieval system