Neodiprion pinetum (white pine sawfly): 124223820 Help Entry 124223820         CDS       T08966                                  Symbol Atg12 Name (RefSeq) autophagy protein 12-like   KO K08336   ubiquitin-like protein ATG12 Organism npt  Neodiprion pinetum (white pine sawfly) Pathway npt04068   FoxO signaling pathway npt04136   Autophagy - other npt04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:npt00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     124223820 (Atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124223820 (Atg12)    04136 Autophagy - other     124223820 (Atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npt04131]     124223820 (Atg12)    04121 Ubiquitin system [BR:npt04121]     124223820 (Atg12)    03029 Mitochondrial biogenesis [BR:npt03029]     124223820 (Atg12) Membrane trafficking [BR:npt04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     124223820 (Atg12) Ubiquitin system [BR:npt04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    124223820 (Atg12) Mitochondrial biogenesis [BR:npt03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     124223820 (Atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  124223820 NCBI-ProteinID:  XP_046492085 LinkDB All DBs Position 7:213273..217574 Genome browser AA seq 145 aa AA seqDB search MADNEEDSLPAVEVPENEDQAGDAPSESDAPQSLEPISSDTNLGPSDQSQTVANKDLAKI DVYLKATGNAPIMKRKKWTVSQDQHIGWIAEFIKKYLKLDPNERLFLYINQTFAPAPDQT VKNLYDCYGIDGKLVIHYCKSHAWG NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggctgataacgaagaggacagtctgccagctgtcgaggtgccggagaacgaggatcag gccggagacgcgccaagcgaaagcgatgctccgcaaagtctggagccgatttcttcggac acaaatttggggcccagcgatcagtcccaaacagtggcaaataaggatttggctaaaatt gacgtctacttgaaggcgacaggcaatgcgccgatcatgaagagaaagaaatggaccgtc agccaggatcagcacattggctggatagcagagttcattaagaaatatttgaaacttgac ccaaatgagagattgtttctgtatattaatcaaacgtttgcaccagcacccgaccagact gttaaaaacctgtacgattgttatggtatcgatggaaagctagtaattcactactgcaaa tctcacgcctggggatga

DBGET integrated database retrieval system