Neodiprion pinetum (white pine sawfly): 138190307 Help Entry 138190307         CDS       T08966                                  Symbol Dlc90F Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism npt  Neodiprion pinetum (white pine sawfly) Pathway npt04814   Motor proteins Brite KEGG Orthology (KO) [BR:npt00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     138190307 (Dlc90F)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:npt03037]     138190307 (Dlc90F)    04812 Cytoskeleton proteins [BR:npt04812]     138190307 (Dlc90F) Cilium and associated proteins [BR:npt03037]  Motile cilia and associated proteins   Dynein arm    138190307 (Dlc90F) Cytoskeleton proteins [BR:npt04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      138190307 (Dlc90F) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  138190307 NCBI-ProteinID:  XP_046491995 LinkDB All DBs Position 7:complement(25325176..25326697) Genome browser AA seq 111 aa AA seqDB search MEDMQEETQFVVDDVSKIIKDAIEVSIGGNAYQHTKVNQWTSHVVEACLGNLTKLQKPYK YIVTCTIMQKNGAGLHTASSCFWDNATDGSCTVRWENKTMYCIVSVFGLAI NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaagatatgcaggaggagacccaatttgtcgtcgacgatgtcagcaagataataaaa gatgcgatcgaggtttccatcgggggcaacgcctaccaacacactaaggttaatcaatgg acatctcacgtagttgaagcctgcctgggaaacctcaccaagctacagaaaccttacaaa tatatcgtgacttgtaccatcatgcaaaagaacggtgcaggcttgcatacggcaagttcg tgcttttgggacaatgcaacggatggaagttgcacagtgcgctgggagaacaaaacgatg tattgtatcgtgtccgtttttggtctggcgatttaa

DBGET integrated database retrieval system