KEGG   Novosphingobium resinovorum: BES08_02465
Entry
BES08_02465       CDS       T04490                                 
Name
(GenBank) peptide ABC transporter permease
  KO
K02034  peptide/nickel transport system permease protein
Organism
nre  Novosphingobium resinovorum
Pathway
nre02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nre00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BES08_02465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nre02000]
    BES08_02465
Transporters [BR:nre02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BES08_02465
SSDB
Motif
Pfam: BPD_transp_1 OppC_N Pmp3
Other DBs
NCBI-ProteinID: AOR75738
UniProt: A0A1D8A0V1
LinkDB
Position
complement(553680..554501)
AA seq 273 aa
MIRQLLRYPSARAAFAILAVVAVLAVFGPFLAPHDPLAQDGSALLQPPGTRYWLGTDALG
RDVFSRLLAGSTVSVLASLLSVSIGLVLGVVPGLLSVFLGRRFEWINLRVIDALMMLPFL
VFAIAMTAMLGNGLVQAMFAVGILITPAFFRVTRAEALSIANAEYIEAARLMGASTSAIL
RRHVVAKVLPPVAVAAASMTGACLSIVASLTFLGIGVVPPDPTWGGLLATDLANLYDRPF
GPVAPALLIVATVWALNALADALRDSGRKETAA
NT seq 822 nt   +upstreamnt  +downstreamnt
atgatacgccagctcctgcgctatcccagcgcccgcgccgccttcgcaattctcgctgtc
gtggccgtactcgccgtcttcgggcctttcctcgcaccgcatgatccgctggcgcaggac
ggctcggcactgctgcaaccacccggcacgagatactggctgggcaccgacgcgctgggc
cgcgacgtcttcagccggttgctcgccggatcgaccgtctccgtccttgcaagcctgctc
tcggtgtcgatcgggttggttctgggcgtcgttcccggcctgctgtcggtctttctcgga
cgccggttcgaatggatcaatctgcgtgtgatcgacgcgctcatgatgctgccgttcctg
gtcttcgccatcgccatgaccgcgatgctgggcaacgggctggtccaggcgatgttcgcc
gtgggcatcctcatcaccccggccttcttccgggtgacccgcgcggaggccctgtccatc
gccaatgccgaatacatcgaggcagcgcgcctgatgggtgcctcgacctccgccatcctg
cgccgccacgtcgtcgccaaagtgctgcccccggtggcggtggccgctgcatcgatgacc
ggcgcgtgcctttcgatcgtcgcctcgctgacattcctcggcatcggcgtcgtgccgccc
gacccgacctggggcggcctgctcgcgaccgacctcgccaacctctacgaccgcccgttc
ggcccggtcgcccctgccctgctgatcgtcgcgacggtctgggcgctcaatgcacttgcc
gacgcgctcagggattccggacgcaaggagaccgccgcatga

DBGET integrated database retrieval system