Novosphingobium resinovorum: BES08_05300 Help Entry BES08_05300       CDS       T04490                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism nre  Novosphingobium resinovorum Pathway nre00190   Oxidative phosphorylation nre01100   Metabolic pathways Module nre_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:nre00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BES08_05300  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:nre00194]     BES08_05300 Photosynthesis proteins [BR:nre00194]  Photosystem and electron transport system   F-type ATPase [OT]    BES08_05300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  AOR76239 UniProt:  A0A031K227 LinkDB All DBs Position 1162547..1162804 Genome browser AA seq 85 aa AA seqDB search MPLHFELVTPAKLVRSEDVHMVVVPGTEGEFGVLAGHAPFMSTIADGALKVYKTENGAPE EIRITGGFAEVGDAGLTVLAEHVEG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcccctgcacttcgaactcgtcacgcctgcgaagctggtccgttccgaggacgtccac atggtggtcgtccccggcaccgaaggcgagttcggcgtgctggcgggccacgcgcccttc atgtcgacgatcgccgatggcgccctgaaggtctacaagaccgagaacggcgcgcccgag gaaatccgcatcaccggcggttttgccgaagtgggtgacgcgggcctgaccgtgctggcc gagcacgtcgaaggctga

DBGET integrated database retrieval system