Novosphingobium resinovorum: BES08_07385 Help Entry BES08_07385       CDS       T04490                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nre  Novosphingobium resinovorum Pathway nre01100   Metabolic pathways nre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BES08_07385    00074 Mycolic acid biosynthesis     BES08_07385   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BES08_07385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AOR76590 UniProt:  A0A031K4I2 LinkDB All DBs Position complement(1596238..1596474) Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKISTVSDAIKYIEENKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgccgatcgggttaagaagatcgtcgtcgagcacctcggcgttgaagcc gagaaggtcaccgaggacgccagcttcatcgacgatctgggcgccgactcgctcgacatc gtcgagctggtcatggcgttcgaggaagaattcggcgtcgagattccggacgatgccgcc gagaagatcagcaccgtctccgatgccatcaagtacatcgaagagaacaagggttaa

DBGET integrated database retrieval system