Novosphingobium resinovorum: BES08_29185 Help Entry BES08_29185       CDS       T04490                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism nre  Novosphingobium resinovorum Brite KEGG Orthology (KO) [BR:nre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:nre03032]     BES08_29185    03036 Chromosome and associated proteins [BR:nre03036]     BES08_29185    03400 DNA repair and recombination proteins [BR:nre03400]     BES08_29185 DNA replication proteins [BR:nre03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BES08_29185 Chromosome and associated proteins [BR:nre03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BES08_29185 DNA repair and recombination proteins [BR:nre03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BES08_29185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 DUF2267 Motif Other DBs NCBI-ProteinID:  AOR80870 UniProt:  A0A1D8AFJ2 LinkDB All DBs Position pSA2:complement(892413..892688) Genome browser AA seq 91 aa AA seqDB search MNNSDLADAIANDAGITKADARKIVDAVFVAIGDAAAKGDEISLNGFGKFKIKDTPEREG RNPATGEAMTIKAARKLTFAPAKAVKDKLNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaacagtgatctcgccgacgccatcgcgaacgatgccggtatcacgaaggccgat gcccgcaagatcgtcgatgctgtcttcgtcgcgatcggcgacgctgcggccaagggcgat gaaatctcgctcaacggcttcggcaagttcaagatcaaggacacacccgagcgcgaaggc cgcaatccggcaaccggcgaggcgatgacgatcaaggccgcccgtaagcttacctttgcc ccggccaaggcggtcaaggacaagctgaacggatga

DBGET integrated database retrieval system