Nocardioides rotundus: K8W59_06270 Help Entry K8W59_06270       CDS       T07669                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nro  Nocardioides rotundus Pathway nro01100   Metabolic pathways nro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K8W59_06270    00074 Mycolic acid biosynthesis     K8W59_06270   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K8W59_06270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 DUF5783 Motif Other DBs NCBI-ProteinID:  UAL31082 LinkDB All DBs Position complement(1261697..1261942) Genome browser AA seq 81 aa AA seqDB search MATTEEIRADLADIVNEVAGIDQADVQMDKSFVDDLDVDSLSMVEVVVAAEEKFGVTIPD DEVKNLKTVGDAVAYIERAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccaccactgaagagatccgcgccgacctggccgacatcgtcaacgaggtcgccgga atcgaccaggccgacgtccagatggacaagtccttcgtcgacgacctcgacgtcgactcg ctgtccatggttgaggtcgtcgtggccgccgaggagaagttcggcgtgaccatccccgac gacgaggtgaagaacctcaagaccgtgggcgacgccgtcgcctacatcgagcgcgctcag gcctga

DBGET integrated database retrieval system