Natronomonas salina: HWV07_07920 Help Entry HWV07_07920       CDS       T07280                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism nsal  Natronomonas salina Pathway nsal03010   Ribosome Brite KEGG Orthology (KO) [BR:nsal00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HWV07_07920   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HWV07_07920  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nsal03011]     HWV07_07920    04121 Ubiquitin system [BR:nsal04121]     HWV07_07920 Ribosome [BR:nsal03011]  Ribosomal proteins   Eukaryotes    Large subunit     HWV07_07920   Archaea     HWV07_07920 Ubiquitin system [BR:nsal04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HWV07_07920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR zf-CHY DZR_2 DHHC Ribosomal_L37e Motif Other DBs NCBI-ProteinID:  QLD88960 LinkDB All DBs Position 1480532..1480681 Genome browser AA seq 49 aa AA seqDB search MASFEEAEARILDKMICMRCNARNPKRADSCRKCGYKKLRPKAKERRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctagcttcgaagaggccgaggcgcgcatcctcgacaagatgatctgcatgcgctgt aacgctcgcaaccccaagcgcgccgacagctgccggaagtgcggctacaagaaactccgc ccgaaggcgaaggaacgccgcgcggcctga

DBGET integrated database retrieval system