Natronomonas salina: HWV07_16775 Help Entry HWV07_16775       CDS       T07280                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nsal  Natronomonas salina Pathway nsal03010   Ribosome Brite KEGG Orthology (KO) [BR:nsal00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HWV07_16775   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HWV07_16775  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nsal03011]     HWV07_16775    04121 Ubiquitin system [BR:nsal04121]     HWV07_16775   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nsal04147]     HWV07_16775 Ribosome [BR:nsal03011]  Ribosomal proteins   Eukaryotes    Small subunit     HWV07_16775   Archaea     HWV07_16775 Ubiquitin system [BR:nsal04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HWV07_16775 Exosome [BR:nsal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HWV07_16775   Exosomal proteins of colorectal cancer cells    HWV07_16775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPB9 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  QLD90601 LinkDB All DBs Position 3230760..3230894 Genome browser AA seq 44 aa AA seqDB search MARHEFYNDDGTTDKEQCPRCGDTFLGDYGDRKHCGKCSYTEFE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcccgacacgagttctacaacgacgacggcacgacggacaaggagcagtgcccgcgc tgcggcgacaccttcctcggtgactacggcgaccgcaagcactgcgggaagtgcagctac accgagttcgagtag

DBGET integrated database retrieval system