Nonlabens tegetincola: BST91_04925 Help Entry BST91_04925       CDS       T04875                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nsd  Nonlabens tegetincola Pathway nsd01100   Metabolic pathways nsd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nsd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BST91_04925    00074 Mycolic acid biosynthesis     BST91_04925   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BST91_04925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  ARN71037 LinkDB All DBs Position 1043975..1044220 Genome browser AA seq 81 aa AA seqDB search MTTQEIHQKLLEIVKVYLPQDVTESSIKPESHLMQDLGINSAHLVDIVLDVEDTFDIMLD ENDMQQMQRVEDATTVIQNKL NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacaactcaagaaatacatcaaaaattattagaaattgtaaaggtttacttgccacag gatgtgacagaaagttctattaaaccagaaagccacctcatgcaagatctaggaatcaat agcgctcaccttgttgatattgttttggatgtggaagatacttttgatataatgcttgat gaaaacgacatgcagcaaatgcaacgcgttgaggatgcaactacagtcatacagaacaaa ttataa

DBGET integrated database retrieval system