Neisseria subflava: FAH66_03300 Help Entry FAH66_03300       CDS       T06236                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nsf  Neisseria subflava Pathway nsf01100   Metabolic pathways nsf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nsf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FAH66_03300    00074 Mycolic acid biosynthesis     FAH66_03300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FAH66_03300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Sas-6_C_CC Motif Other DBs NCBI-ProteinID:  QCL70609 LinkDB All DBs Position complement(671918..672178) Genome browser AA seq 86 aa AA seqDB search MNNLENQIKELIIDSLGLEDITPADIGSEDPLFGDEGLGLDSVDALELGLAVQKTFGFQL DGENDNLRENFANVKTLAEFVKSRQA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaataacttagaaaaccaaatcaaagaattaatcatcgacagcttggggctggaagac atcacccctgccgacatcggcagcgaagacccgctcttcggcgacgaaggcttgggttta gattccgtcgacgcgctggaactcggtttggcagtgcaaaaaaccttcggcttccagctc gacggtgaaaacgacaacctgcgcgaaaacttcgccaacgtcaaaacactggccgagttc gtcaagagccgccaagcataa

DBGET integrated database retrieval system