Neisseria shayeganii: H3L94_01370 Help Entry H3L94_01370       CDS       T07084                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism nsg  Neisseria shayeganii Brite KEGG Orthology (KO) [BR:nsg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nsg03036]     H3L94_01370 (ftsL) Chromosome and associated proteins [BR:nsg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     H3L94_01370 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL COX16 Motif Other DBs NCBI-ProteinID:  QMT40740 UniProt:  A0A7D7N5N1 LinkDB All DBs Position 292320..292586 Genome browser AA seq 88 aa AA seqDB search MNKINIVLFVLTVLSALAVVTVQDRSRESFIALEKEHRRALDLEEEFRRLQWQQAQLANH ARIKEAAARQQLQPPTVQNTHMIRTHHE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaatcaatatcgtcctctttgtgctcaccgtgctctcggcgctggccgtggtc accgtgcaggaccgctcgcgcgaatcgtttatcgcgctggaaaaagagcaccgccgcgcc ttggacttggaagaagaattccgccgtctgcaatggcagcaggcccagctggccaaccat gcccgcattaaagaggcggcggcgcgccagcagctgcagccgcctaccgtacagaatacc cacatgatccgcacacaccacgaataa

DBGET integrated database retrieval system