Neisseria shayeganii: H3L94_02760 Help Entry H3L94_02760       CDS       T07084                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism nsg  Neisseria shayeganii Brite KEGG Orthology (KO) [BR:nsg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:nsg03036]     H3L94_02760 (ftsB) Chromosome and associated proteins [BR:nsg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     H3L94_02760 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC HALZ Motif Other DBs NCBI-ProteinID:  QMT40985 UniProt:  A0A7D7N431 LinkDB All DBs Position 581099..581386 Genome browser AA seq 95 aa AA seqDB search MKWVTLVLLAALLWLQQGLWLSKGGWRDMWRLEAEVEAQSLANDALVVRNQALAAEVEDL RNGQDAIAEIARTDLGYVQSGETFYRILPAETAAE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaaatgggtaacgctggttttactggccgccttgctttggctgcaacaaggtttatgg ctgtctaaaggcggttggcgcgatatgtggcgcttagaagcagaagtggaagcccaaagc cttgccaacgacgcattggtggttcgcaaccaagctttggctgccgaagtggaagattta cgcaacggtcaagacgccattgccgaaatcgccagaaccgatctaggctatgtgcaaagc ggcgaaaccttctaccgcatcttgccggcagagaccgcagcagaataa

DBGET integrated database retrieval system