KEGG   Neisseria shayeganii: H3L94_08525
Entry
H3L94_08525       CDS       T07084                                 
Symbol
sstT
Name
(GenBank) serine/threonine transporter SstT
  KO
K07862  serine/threonine transporter
Organism
nsg  Neisseria shayeganii
Brite
KEGG Orthology (KO) [BR:nsg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nsg02000]
    H3L94_08525 (sstT)
Transporters [BR:nsg02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   H3L94_08525 (sstT)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-ProteinID: QMT39902
UniProt: A0A7D7RM43
LinkDB
Position
complement(1742351..1743580)
AA seq 409 aa
MAKQNWAAALDRIGLVMQIVIGLILGVLVGWLSRDTGMGGAVGELGQILGGLFVGALKAV
APILIFVLVTAAISQSRSGTATNMRPILLLYLFGTFAAALVAVSASFAFPSTLTLSGVEA
ATREAPGGIGEVMRNLLMKLVSNPIQALADANYIGILAWALVLGAALRQAGERTRELIAD
LAAAVSTVVRWVIRFAPLGIFGLVLTTIIVEGFSGIGRYVHLLAVLLGAMLFVALVVNPL
IVFAQTRSNPYPLVFTCLRESGMTAFFTRSSAANIPVNMALAKKLGLNEDTYSVSIPLGA
TINMAGAAITITVLTLAAVHTLGIEVDFWTAVLLSVVASLGACGASGVAGGSLLLIPMAC
SLFNIENDIAMQVVAVGFIIGVVQDSAETALNSSTDVLFTAAVDQARRR
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcaaaacaaaattgggcggctgctttagaccgcatcggtttggtgatgcagatcgtg
atcggtctgattttgggtgtgctggtgggctggctgtcgcgcgacaccggcatgggcggt
gcggtcggcgaattgggtcagattctgggcggcctgtttgtgggcgcgctcaaagcggtg
gcgccgattctgattttcgtgttggtgacggcagccatttcgcaaagccgcagcggcacg
gccaccaatatgcggccgattctgttgctgtatctgttcggtacttttgccgcagcgctg
gtggccgtgagtgcgagctttgcttttccctccacgctcaccctgagcggcgtggaagcg
gccacgcgcgaggcacccggcggcatcggcgaagtgatgcgcaatctgttgatgaagctg
gtgtccaatccgatacaggccctggccgatgccaactacatcggtattttggcgtgggcc
ttggtgttgggcgcggctttgcgccaagccggcgagcgcacccgcgagctgattgccgac
ttggcggctgcggtatcgacggtggtgcgctgggtgatccgcttcgcgcccttgggtatt
ttcggtttggtgctgaccaccattatcgtggaaggtttcagcggcatcggccgttatgtg
cacctgttggcggtgctgctgggcgccatgctgtttgtggcgctggtggtgaaccctttg
attgtgtttgcccaaacccgcagcaatccttatccgctggtgttcacctgcctgcgcgag
agcggaatgacggccttctttacccgatcctccgccgccaatatcccggtgaacatggct
ttggcgaaaaagctcggcctcaatgaagacacttattcggtgtcgattccgctgggcgcc
accatcaatatggccggtgcggccattaccatcaccgtgctcacgctggcggcggtgcac
actttgggcattgaagtcgatttctggaccgcggtcttgttgagcgtggtggcctcgctt
ggcgcctgcggcgcttccggcgtggccggcggctcgctgctgctgattccgatggcgtgc
agcctgtttaatatcgaaaacgacattgccatgcaggtggtggcggtcggtttcatcatc
ggcgtggtgcaggattccgccgaaacggccttgaattcgtccaccgacgtgctgtttacc
gccgctgtggatcaggcccgccggcgttga

DBGET integrated database retrieval system