Nostoc sphaeroides: GXM_00633 Help Entry GXM_00633         CDS       T06325                                  Name (GenBank) acpP, acyl carrier protein   KO K02078   acyl carrier protein Organism nsh  Nostoc sphaeroides Pathway nsh01100   Metabolic pathways nsh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nsh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GXM_00633    00074 Mycolic acid biosynthesis     GXM_00633   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GXM_00633 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QFS43160 UniProt:  A0A5P8VS42 LinkDB All DBs Position Gxm1:complement(606073..606297) Genome browser AA seq 74 aa AA seqDB search MQAFYEGLAEILEIDVNEVSPSLDLTRMDWDSLAFISTIALVDDCFNVMLNGDSLAASKT VGDIEKIISQKQKG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgcaagctttttacgaaggtctagccgaaatacttgagattgatgtcaatgaagtttct ccaagccttgacctaactcgaatggactgggattcccttgcatttatttctacaattgcg ctagttgatgactgctttaatgtgatgctgaatggagactctcttgccgcttctaagaca gtgggagatattgaaaaaatcatttcccaaaagcaaaaaggataa

DBGET integrated database retrieval system