Nocardia mangyaensis: BOX37_20135 Help Entry BOX37_20135       CDS       T04582                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism nsl  Nocardia mangyaensis Pathway nsl01100   Metabolic pathways nsl01110   Biosynthesis of secondary metabolites Module nsl_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:nsl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BOX37_20135    00074 Mycolic acid biosynthesis     BOX37_20135   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BOX37_20135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  APE35873 UniProt:  A0A1J0VV45 LinkDB All DBs Position 4492520..4492759 Genome browser AA seq 79 aa AA seqDB search MNADTVEAALLVAFATRLASDPADIEPDQAIADLPGIDSLAMLRVIVDVETALGIQIPDD TAYAATTVRQLAKLIAEQA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaacgcggacaccgtggaagctgccctcctcgtcgcgttcgcgacccggctggcatcc gaccccgccgatatcgaaccggaccaggcgatcgcggacttgcccggcatcgattccctc gccatgctgcgcgtcatcgtcgacgtcgaaaccgctctcggcatacagattcccgacgac accgcctacgccgcgaccaccgtgcggcagctcgcgaaactcatcgcggagcaggcgtga

DBGET integrated database retrieval system