Neotabrizicola shimadae: JO391_01185 Help Entry JO391_01185       CDS       T08148                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism nsm  Neotabrizicola shimadae Brite KEGG Orthology (KO) [BR:nsm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:nsm03110]     JO391_01185 (groES)    03029 Mitochondrial biogenesis [BR:nsm03029]     JO391_01185 (groES) Chaperones and folding catalysts [BR:nsm03110]  Heat shock proteins   HSP10    JO391_01185 (groES) Mitochondrial biogenesis [BR:nsm03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     JO391_01185 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  QYZ70179 UniProt:  A0A8G0ZY16 LinkDB All DBs Position 242931..243218 Genome browser AA seq 95 aa AA seqDB search MAFKPLHDRVLVRRVQSEEKTKGGLIIPDTAKEKPAEGEIVAVGEGARKDSGELIAPSVK AGDRILFGKWSGTEVTLNGEDLLIMKESDILGIIA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctttcaaaccgctgcatgaccgtgtgctggtccgccgcgtccagtccgaggaaaag accaagggtggtctgatcatccccgacaccgcgaaggaaaagcccgccgagggtgagatc gtcgccgtgggcgaaggcgcccgcaaggattcgggcgagctgatcgccccgtcggtgaag gcgggcgaccgcatcctgttcggcaagtggtcgggcaccgaggtcacgctgaacggcgaa gacctgctgatcatgaaggaaagcgacatcctcggcatcatcgcctga

DBGET integrated database retrieval system