Neotabrizicola shimadae: JO391_04945 Help Entry JO391_04945       CDS       T08148                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nsm  Neotabrizicola shimadae Pathway nsm01100   Metabolic pathways nsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nsm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JO391_04945    00074 Mycolic acid biosynthesis     JO391_04945   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JO391_04945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  QYZ70863 UniProt:  A0A8G0ZVE0 LinkDB All DBs Position 1044309..1044542 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFSIEIPDDAA ETIQTFGDAVKFISSAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgccgatcgcgtgaagaagatcgtcgtcgagcatctgggcgtggaagag gacaaggtgaccgagaatgcctcgttcatcgacgacctcggcgcagactcgctggatacc gtcgaactggtgatggctttcgaggaagagttctcgatcgagatcccggacgacgcggcc gagaccatccagaccttcggcgatgcggtgaagttcatctcctccgccgtctga

DBGET integrated database retrieval system