Neotabrizicola shimadae: JO391_06980 Help Entry JO391_06980       CDS       T08148                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nsm  Neotabrizicola shimadae Pathway nsm01100   Metabolic pathways nsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nsm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JO391_06980    00074 Mycolic acid biosynthesis     JO391_06980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JO391_06980 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding CFAP70_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QYZ71242 UniProt:  A0A8G0ZY82 LinkDB All DBs Position complement(1441504..1441770) Genome browser AA seq 88 aa AA seqDB search MSETIGQEVIRIIAHQAVLDVADVTPESTLQSLGIDSLGLVEAIFAIEETFDITVPFNAN DPSSSEFDISSVASVIGAVEKLVALKTG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtcagagacaatcgggcaagaggtgatccgcatcatcgcgcaccaagcagtgctggat gtggccgacgtgaccccggagtcgacgctgcaaagccttggcatcgacagccttggtctg gtcgaggccattttcgcgattgaagagactttcgacatcacagtgccctttaacgccaat gatccatcgagcagcgagttcgacatttcttccgtggcctccgtgatcggagccgtggaa aaactggtcgcgttgaagaccggatga

DBGET integrated database retrieval system