Neotabrizicola shimadae: JO391_08750 Help Entry JO391_08750       CDS       T08148                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism nsm  Neotabrizicola shimadae Pathway nsm00190   Oxidative phosphorylation nsm01100   Metabolic pathways Module nsm_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:nsm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     JO391_08750  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:nsm00194]     JO391_08750 Photosynthesis proteins [BR:nsm00194]  Photosystem and electron transport system   F-type ATPase [OT]    JO391_08750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QYZ71564 UniProt:  A0A8G1EF59 LinkDB All DBs Position complement(1828480..1828719) Genome browser AA seq 79 aa AA seqDB search MEIVAAAALGKFIGAGLAAIGSGAAAIGVGNVAGNFLAGALRNPSAAGSQTATLFIGLAF AEALGIFAFLVALLLMFAV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaatcgtcgccgctgccgctctgggcaagttcatcggtgctggtcttgccgccatc ggctcgggcgctgccgccatcggtgtgggcaacgttgccggcaacttcctggccggcgcc ctgcgcaacccttcggccgccggttcgcaaaccgcgaccctgttcatcggcctggccttc gccgaagcccttggcatcttcgccttcctcgtcgccctgctgctgatgttcgcagtctga

DBGET integrated database retrieval system