Nodularia spumigena: BMF81_04148 Help Entry BMF81_04148       CDS       T05403                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism nsp  Nodularia spumigena Pathway nsp00998   Biosynthesis of various antibiotics nsp01100   Metabolic pathways nsp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nsp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BMF81_04148 (acpP)    00074 Mycolic acid biosynthesis     BMF81_04148 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BMF81_04148 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 Ribosomal_L50 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  AVZ31427 UniProt:  A0A2S0QAN3 LinkDB All DBs Position complement(4686325..4686579) Genome browser AA seq 84 aa AA seqDB search MNEADIIFEKVKTIVKEQLSEDEDKITPEANFANDLGADSLDTVELVMALEEEFDIEIPD EAAEKITTVQEAVDYIKDKVAASA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaatgaagcagacattatttttgaaaaggtcaagacaattgttaaggagcaactcagt gaagacgaagacaaaattacaccagaagctaatttcgccaatgatctgggggctgattcc ctagataccgttgaattagttatggcattggaagaagaatttgatatcgaaattcccgat gaagccgccgaaaaaattacgacggttcaagaagcggtggattacatcaaagataaagtt gctgcatccgcctaa

DBGET integrated database retrieval system