Nodularia sphaerocarpa: BDGGKGIB_00088 Help Entry BDGGKGIB_00088    CDS       T08134                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism nsph  Nodularia sphaerocarpa Pathway nsph00998   Biosynthesis of various antibiotics nsph01100   Metabolic pathways nsph01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nsph00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BDGGKGIB_00088 (acpP_1)    00074 Mycolic acid biosynthesis     BDGGKGIB_00088 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BDGGKGIB_00088 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N HLH DUF5783 Ribosomal_L50 WGG Motif Other DBs NCBI-ProteinID:  ULP70472 LinkDB All DBs Position complement(109848..110099) Genome browser AA seq 83 aa AA seqDB search MSQSDIFAKVKKIVVDQLSVEEDKITPEANFANDLGADSLDTVELVMALEEEFDIEIPDE SAEKITTVQEAVDYIKDKVAASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtcaatcagacatttttgcaaaagtcaagaaaattgttgtcgatcaactcagtgtt gaagaagacaaaattacaccagaagctaatttcgccaatgatctgggggctgattcccta gatacagtggaattagttatggcattagaagaagaatttgatatcgaaattcccgatgaa tccgccgaaaaaattacgacggttcaagaggctgtggattacatcaaagataaagttgct gcatccgcctaa

DBGET integrated database retrieval system