Nocardia seriolae: NS506_07302 Help Entry NS506_07302       CDS       T04599                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism nsr  Nocardia seriolae Pathway nsr00074   Mycolic acid biosynthesis nsr00280   Valine, leucine and isoleucine degradation nsr00630   Glyoxylate and dicarboxylate metabolism nsr00640   Propanoate metabolism nsr01100   Metabolic pathways nsr01110   Biosynthesis of secondary metabolites nsr01120   Microbial metabolism in diverse environments nsr01200   Carbon metabolism Module nsr_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA nsr_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:nsr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     NS506_07302    00640 Propanoate metabolism     NS506_07302   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     NS506_07302   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     NS506_07302 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  APB01322 UniProt:  A0ABC8B4T0 LinkDB All DBs Position complement(7632537..7632857) Genome browser AA seq 106 aa AA seqDB search MTTMADEEVLRAAELDLAVDELADAVDTAVTEIELPSTGPVIQVLKGNPTDLELAALVAV FAAAASASAAPADKGPADMWGRPTLLHRGSSPFSPYAFPALSHLRD NT seq 321 nt NT seq  +upstreamnt  +downstreamnt gtgacgaccatggccgatgaagaagtgctgcgcgccgccgaactggatctagccgtcgac gagttggccgacgccgtcgatacggccgtcaccgagatcgagctcccgagcaccggaccg gtcatccaggtcctcaagggcaacccgaccgatctcgaactggccgccctggtcgccgtg ttcgccgccgcggcgagcgcctcggccgccccggccgacaagggcccggccgacatgtgg ggccgccccaccctgctgcaccgcggctcctcgccgttctcgccctacgctttcccggcg ctctcgcacctgcgcgactga

DBGET integrated database retrieval system