Notechis scutatus (mainland tiger snake): 113428199
Help
Entry
113428199 CDS
T09026
Symbol
SLC16A13
Name
(RefSeq) LOW QUALITY PROTEIN: monocarboxylate transporter 13
KO
K08189
MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 13
Organism
nss
Notechis scutatus (mainland tiger snake)
Brite
KEGG Orthology (KO) [BR:
nss00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
nss02000
]
113428199 (SLC16A13)
Transporters [BR:
nss02000
]
Solute carrier family (SLC)
SLC16: Monocarboxylate transporter
113428199 (SLC16A13)
Major facilitator superfamily (MFS)
Organic acid transporters
Monocarboxylate transporter (MCT) family [TC:
2.A.1.13
]
113428199 (SLC16A13)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
MFS_1
Motif
Other DBs
NCBI-GeneID:
113428199
NCBI-ProteinID:
XP_026546543
UniProt:
A0A6J1W0Z7
LinkDB
All DBs
Position
Unknown
AA seq
562 aa
AA seq
DB search
MNETEGGVASSPGPASFGSCNIVASRFLPNPPSLQRGASGGCRPHPPKYPGSMLVRRAVV
PAPPDGGWGWVVVLAAFLQSALVFGVLRSFGVFFVEFVAHFQELSGRISWITSIGIAGQQ
RLXPGLSFFAGPVGTALSSHYGARPVIMVGGFLSGLGLLLASFATRLVHLYLSIGLLSGF
GWALVFTPSVASVACYFKRRRTLATSLALTGVGISSFAFSPLFQFLVDSYAWRGALMIVA
GMSFNLVVCGALIRPLTLKDDVPGGKLTARSWKTLSNLFGLQLLSHCPFMRYVAAITLVN
TGYFIPYVHLVAWARELGFDEYQAAFLMSLTAAADLCGRLFSGWLGSCRSSQLIHLLVAW
AFLTGLSLVLIAWGRTYPLLVAISLGYGFFSGALTPVVFSIVPEIVGIENIFSAMGLLQM
IESVGGLLGSPLSGWLRDLTGNYAASFLAAGSFLLAGSLVLMTVPNFSTCLTQPDWHDAR
LGRESGDYDSRLTSVAPAGLSTQKGGPAAEQTPIEELNGCRNPKVGFESRAEMDGFVEQN
TCACDRMCKGASKNQGLFVAAT
NT seq
1689 nt
NT seq
+upstream
nt +downstream
nt
atgaacgagacggaggggggcgtggcttctagcccaggccccgcctcctttggctcctgc
aacattgtcgccagccgcttccttccgaacccgccgtcgctgcagaggggggcgtcaggg
gggtgtcgcccccaccctcccaaataccccggctccatgctggtccggagagctgtggtg
ccggcccccccagatgggggctggggctgggtggtggtcttggctgccttcctccagtcc
gccttggtcttcggcgttttgcgctccttcggcgttttcttcgtggagtttgtggctcat
ttccaggaattgtccggacggatttcctggatcacttccattgggatcgccgggcagcag
agattgtaaccaggtttatcattctttgcaggtcctgtgggaacggccctgagttcccac
tatggggctcggcctgtgattatggttggtgggtttctctccgggctggggctcctgttg
gcatcgtttgctacccggttggtgcatttatatctcagcattggcctcctttcagggttc
ggctgggccttggtcttcacaccttccgtggcctccgtggcttgctacttcaagcgccgc
cggaccctggctaccagtttggccctcactggcgtgggcatctcctcctttgctttctcc
ccgctcttccaattcctggtggactcctatgcctggaggggcgccctgatgatcgtggcc
ggcatgtccttcaacctcgtggtctgcggcgccctcatccggcccctgaccctcaaggac
gacgtgcccggcggaaagctgacggcacggagctggaagacgctctccaatctctttggc
ctgcagctgctttcccactgccccttcatgcggtacgtggcggccatcaccttggtcaac
acaggctatttcatcccctatgtccacttggtggcttgggcgcgagaactgggcttcgat
gaataccaggctgcctttctgatgtccctcacggccgcggctgatctttgcggacgcctc
ttctccggctggctgggcagctgcaggtcatcgcagttgatccacctgctggtagcctgg
gctttcttgacgggcctctccttggtgctgatcgcctgggggcgcacctacccgctcctc
gtggccatcagccttggctacggattcttctcgggagccctgacacccgtggtcttctcc
atcgttccggagatcgtgggcatcgagaacatcttcagtgccatggggctgctgcagatg
atcgaaagcgtcggggggctgttggggtcccccctgtcgggttggctgcgagacctcacc
ggcaactacgcggcctccttccttgccgccggctctttcctcttggctgggagcctcgtc
ctgatgacggtgcccaatttctccacctgcctgacccagccggattggcacgatgcccgg
cttggcagagagtccggggattatgatagccgcttgacctcggtggctcctgcaggccta
tctacccaaaagggggggccggcggccgagcagacccccattgaagagctgaatggctgc
aggaatccaaaggtgggatttgaatccagagcagagatggacggctttgttgagcagaac
acatgtgcatgtgatcgaatgtgtaaaggcgcaagcaagaaccaggggttatttgtcgca
gcgacataa
DBGET
integrated database retrieval system