KEGG   Neomonachus schauinslandi (Hawaiian monk seal): 110580342
Entry
110580342         CDS       T08474                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
nsu  Neomonachus schauinslandi (Hawaiian monk seal)
Pathway
nsu01521  EGFR tyrosine kinase inhibitor resistance
nsu01522  Endocrine resistance
nsu04010  MAPK signaling pathway
nsu04012  ErbB signaling pathway
nsu04014  Ras signaling pathway
nsu04015  Rap1 signaling pathway
nsu04062  Chemokine signaling pathway
nsu04068  FoxO signaling pathway
nsu04071  Sphingolipid signaling pathway
nsu04072  Phospholipase D signaling pathway
nsu04137  Mitophagy - animal
nsu04140  Autophagy - animal
nsu04150  mTOR signaling pathway
nsu04151  PI3K-Akt signaling pathway
nsu04210  Apoptosis
nsu04211  Longevity regulating pathway
nsu04213  Longevity regulating pathway - multiple species
nsu04218  Cellular senescence
nsu04360  Axon guidance
nsu04370  VEGF signaling pathway
nsu04371  Apelin signaling pathway
nsu04540  Gap junction
nsu04550  Signaling pathways regulating pluripotency of stem cells
nsu04625  C-type lectin receptor signaling pathway
nsu04650  Natural killer cell mediated cytotoxicity
nsu04660  T cell receptor signaling pathway
nsu04662  B cell receptor signaling pathway
nsu04664  Fc epsilon RI signaling pathway
nsu04714  Thermogenesis
nsu04720  Long-term potentiation
nsu04722  Neurotrophin signaling pathway
nsu04725  Cholinergic synapse
nsu04726  Serotonergic synapse
nsu04730  Long-term depression
nsu04810  Regulation of actin cytoskeleton
nsu04910  Insulin signaling pathway
nsu04912  GnRH signaling pathway
nsu04915  Estrogen signaling pathway
nsu04916  Melanogenesis
nsu04917  Prolactin signaling pathway
nsu04919  Thyroid hormone signaling pathway
nsu04921  Oxytocin signaling pathway
nsu04926  Relaxin signaling pathway
nsu04929  GnRH secretion
nsu04933  AGE-RAGE signaling pathway in diabetic complications
nsu04935  Growth hormone synthesis, secretion and action
nsu05010  Alzheimer disease
nsu05022  Pathways of neurodegeneration - multiple diseases
nsu05034  Alcoholism
nsu05160  Hepatitis C
nsu05161  Hepatitis B
nsu05163  Human cytomegalovirus infection
nsu05165  Human papillomavirus infection
nsu05166  Human T-cell leukemia virus 1 infection
nsu05167  Kaposi sarcoma-associated herpesvirus infection
nsu05170  Human immunodeficiency virus 1 infection
nsu05200  Pathways in cancer
nsu05203  Viral carcinogenesis
nsu05205  Proteoglycans in cancer
nsu05206  MicroRNAs in cancer
nsu05207  Chemical carcinogenesis - receptor activation
nsu05208  Chemical carcinogenesis - reactive oxygen species
nsu05210  Colorectal cancer
nsu05211  Renal cell carcinoma
nsu05213  Endometrial cancer
nsu05214  Glioma
nsu05215  Prostate cancer
nsu05216  Thyroid cancer
nsu05218  Melanoma
nsu05219  Bladder cancer
nsu05220  Chronic myeloid leukemia
nsu05221  Acute myeloid leukemia
nsu05223  Non-small cell lung cancer
nsu05224  Breast cancer
nsu05225  Hepatocellular carcinoma
nsu05226  Gastric cancer
nsu05230  Central carbon metabolism in cancer
nsu05231  Choline metabolism in cancer
nsu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nsu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110580342 (NRAS)
   04012 ErbB signaling pathway
    110580342 (NRAS)
   04014 Ras signaling pathway
    110580342 (NRAS)
   04015 Rap1 signaling pathway
    110580342 (NRAS)
   04370 VEGF signaling pathway
    110580342 (NRAS)
   04371 Apelin signaling pathway
    110580342 (NRAS)
   04068 FoxO signaling pathway
    110580342 (NRAS)
   04072 Phospholipase D signaling pathway
    110580342 (NRAS)
   04071 Sphingolipid signaling pathway
    110580342 (NRAS)
   04151 PI3K-Akt signaling pathway
    110580342 (NRAS)
   04150 mTOR signaling pathway
    110580342 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110580342 (NRAS)
   04137 Mitophagy - animal
    110580342 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    110580342 (NRAS)
   04218 Cellular senescence
    110580342 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110580342 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    110580342 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110580342 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110580342 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    110580342 (NRAS)
   04660 T cell receptor signaling pathway
    110580342 (NRAS)
   04662 B cell receptor signaling pathway
    110580342 (NRAS)
   04664 Fc epsilon RI signaling pathway
    110580342 (NRAS)
   04062 Chemokine signaling pathway
    110580342 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110580342 (NRAS)
   04929 GnRH secretion
    110580342 (NRAS)
   04912 GnRH signaling pathway
    110580342 (NRAS)
   04915 Estrogen signaling pathway
    110580342 (NRAS)
   04917 Prolactin signaling pathway
    110580342 (NRAS)
   04921 Oxytocin signaling pathway
    110580342 (NRAS)
   04926 Relaxin signaling pathway
    110580342 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    110580342 (NRAS)
   04919 Thyroid hormone signaling pathway
    110580342 (NRAS)
   04916 Melanogenesis
    110580342 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    110580342 (NRAS)
   04726 Serotonergic synapse
    110580342 (NRAS)
   04720 Long-term potentiation
    110580342 (NRAS)
   04730 Long-term depression
    110580342 (NRAS)
   04722 Neurotrophin signaling pathway
    110580342 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    110580342 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    110580342 (NRAS)
   04213 Longevity regulating pathway - multiple species
    110580342 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    110580342 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110580342 (NRAS)
   05206 MicroRNAs in cancer
    110580342 (NRAS)
   05205 Proteoglycans in cancer
    110580342 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    110580342 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    110580342 (NRAS)
   05203 Viral carcinogenesis
    110580342 (NRAS)
   05230 Central carbon metabolism in cancer
    110580342 (NRAS)
   05231 Choline metabolism in cancer
    110580342 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110580342 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110580342 (NRAS)
   05225 Hepatocellular carcinoma
    110580342 (NRAS)
   05226 Gastric cancer
    110580342 (NRAS)
   05214 Glioma
    110580342 (NRAS)
   05216 Thyroid cancer
    110580342 (NRAS)
   05221 Acute myeloid leukemia
    110580342 (NRAS)
   05220 Chronic myeloid leukemia
    110580342 (NRAS)
   05218 Melanoma
    110580342 (NRAS)
   05211 Renal cell carcinoma
    110580342 (NRAS)
   05219 Bladder cancer
    110580342 (NRAS)
   05215 Prostate cancer
    110580342 (NRAS)
   05213 Endometrial cancer
    110580342 (NRAS)
   05224 Breast cancer
    110580342 (NRAS)
   05223 Non-small cell lung cancer
    110580342 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110580342 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    110580342 (NRAS)
   05161 Hepatitis B
    110580342 (NRAS)
   05160 Hepatitis C
    110580342 (NRAS)
   05163 Human cytomegalovirus infection
    110580342 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110580342 (NRAS)
   05165 Human papillomavirus infection
    110580342 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110580342 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    110580342 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    110580342 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110580342 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110580342 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110580342 (NRAS)
   01522 Endocrine resistance
    110580342 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nsu04131]
    110580342 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nsu04147]
    110580342 (NRAS)
   04031 GTP-binding proteins [BR:nsu04031]
    110580342 (NRAS)
Membrane trafficking [BR:nsu04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    110580342 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110580342 (NRAS)
Exosome [BR:nsu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110580342 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   110580342 (NRAS)
  Exosomal proteins of breast cancer cells
   110580342 (NRAS)
  Exosomal proteins of colorectal cancer cells
   110580342 (NRAS)
GTP-binding proteins [BR:nsu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110580342 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 110580342
NCBI-ProteinID: XP_021545695
UniProt: A0A2Y9H767
LinkDB
Position
4:complement(95154196..95164438)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagcgcattgaca
atccagctaatccagaaccattttgtagatgagtatgatcccaccatagaggattcttac
cgaaagcaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaataagtgtgatttg
ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcaatgatgatggaactcaaggt
tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system