KEGG   Neomonachus schauinslandi (Hawaiian monk seal): 110586587
Entry
110586587         CDS       T08474                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
nsu  Neomonachus schauinslandi (Hawaiian monk seal)
Pathway
nsu04014  Ras signaling pathway
nsu04015  Rap1 signaling pathway
nsu04020  Calcium signaling pathway
nsu04022  cGMP-PKG signaling pathway
nsu04024  cAMP signaling pathway
nsu04070  Phosphatidylinositol signaling system
nsu04114  Oocyte meiosis
nsu04218  Cellular senescence
nsu04261  Adrenergic signaling in cardiomyocytes
nsu04270  Vascular smooth muscle contraction
nsu04371  Apelin signaling pathway
nsu04625  C-type lectin receptor signaling pathway
nsu04713  Circadian entrainment
nsu04720  Long-term potentiation
nsu04722  Neurotrophin signaling pathway
nsu04728  Dopaminergic synapse
nsu04740  Olfactory transduction
nsu04744  Phototransduction
nsu04750  Inflammatory mediator regulation of TRP channels
nsu04910  Insulin signaling pathway
nsu04912  GnRH signaling pathway
nsu04915  Estrogen signaling pathway
nsu04916  Melanogenesis
nsu04921  Oxytocin signaling pathway
nsu04922  Glucagon signaling pathway
nsu04924  Renin secretion
nsu04925  Aldosterone synthesis and secretion
nsu04970  Salivary secretion
nsu04971  Gastric acid secretion
nsu05010  Alzheimer disease
nsu05012  Parkinson disease
nsu05022  Pathways of neurodegeneration - multiple diseases
nsu05031  Amphetamine addiction
nsu05034  Alcoholism
nsu05133  Pertussis
nsu05152  Tuberculosis
nsu05163  Human cytomegalovirus infection
nsu05167  Kaposi sarcoma-associated herpesvirus infection
nsu05170  Human immunodeficiency virus 1 infection
nsu05200  Pathways in cancer
nsu05214  Glioma
nsu05417  Lipid and atherosclerosis
nsu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110586587
   04015 Rap1 signaling pathway
    110586587
   04371 Apelin signaling pathway
    110586587
   04020 Calcium signaling pathway
    110586587
   04070 Phosphatidylinositol signaling system
    110586587
   04024 cAMP signaling pathway
    110586587
   04022 cGMP-PKG signaling pathway
    110586587
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110586587
   04218 Cellular senescence
    110586587
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110586587
  09152 Endocrine system
   04910 Insulin signaling pathway
    110586587
   04922 Glucagon signaling pathway
    110586587
   04912 GnRH signaling pathway
    110586587
   04915 Estrogen signaling pathway
    110586587
   04921 Oxytocin signaling pathway
    110586587
   04916 Melanogenesis
    110586587
   04924 Renin secretion
    110586587
   04925 Aldosterone synthesis and secretion
    110586587
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110586587
   04270 Vascular smooth muscle contraction
    110586587
  09154 Digestive system
   04970 Salivary secretion
    110586587
   04971 Gastric acid secretion
    110586587
  09156 Nervous system
   04728 Dopaminergic synapse
    110586587
   04720 Long-term potentiation
    110586587
   04722 Neurotrophin signaling pathway
    110586587
  09157 Sensory system
   04744 Phototransduction
    110586587
   04740 Olfactory transduction
    110586587
   04750 Inflammatory mediator regulation of TRP channels
    110586587
  09159 Environmental adaptation
   04713 Circadian entrainment
    110586587
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110586587
  09162 Cancer: specific types
   05214 Glioma
    110586587
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110586587
   05163 Human cytomegalovirus infection
    110586587
   05167 Kaposi sarcoma-associated herpesvirus infection
    110586587
  09171 Infectious disease: bacterial
   05133 Pertussis
    110586587
   05152 Tuberculosis
    110586587
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110586587
   05012 Parkinson disease
    110586587
   05022 Pathways of neurodegeneration - multiple diseases
    110586587
  09165 Substance dependence
   05031 Amphetamine addiction
    110586587
   05034 Alcoholism
    110586587
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110586587
   05418 Fluid shear stress and atherosclerosis
    110586587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nsu01009]
    110586587
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nsu04131]
    110586587
   03036 Chromosome and associated proteins [BR:nsu03036]
    110586587
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nsu04147]
    110586587
Protein phosphatases and associated proteins [BR:nsu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     110586587
Membrane trafficking [BR:nsu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    110586587
Chromosome and associated proteins [BR:nsu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     110586587
Exosome [BR:nsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110586587
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EF_EFCAB10_C EH Dockerin_1 Temptin_C EF-hand_11 EFhand_Ca_insen Caleosin DUF5580_M SurA_N_3 SurA_N_2 Fe_hyd_lg_C
Other DBs
NCBI-GeneID: 110586587
NCBI-ProteinID: XP_021552486
UniProt: A0A2Y9HLB6
LinkDB
Position
5:complement(132672116..132673443)
AA seq 149 aa
MADQLSEEQVAEFKEAFCLFDKDGDGVITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG
NGSVDFPEFLGMMARQLRGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDE
EVDEMIRAADVDGDGQVNYEEFVHMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgaccagctgagcgaggaacaggtggccgagttcaaggaggccttctgcctgttc
gacaaggacggggacggtgtcatcaccacccaggagctgggcaccgtcatgcgctccctg
ggccagaaccccacggaggccgagctgcgggacatggtgggcgagatcgaccgcgacggc
aatggctccgtggacttccctgagttcctgggcatgatggccaggcagctgaggggcagg
gacagcgaggagcagatccgcgaggccttccgcgtctttgacaaggacggcaacggcctg
gtgagcgcggccgagctgcggcacgtgatgaccaggctaggggagaagctgagtgacgag
gaggtggacgagatgatccgggccgccgacgtggacggggacgggcaggtgaactacgag
gagttcgtccacatgctggtgtccaagtga

DBGET integrated database retrieval system