Nicotiana sylvestris (wood tobacco): 104226402 Help Entry 104226402         CDS       T05026                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism nsy  Nicotiana sylvestris (wood tobacco) Pathway nsy04016   MAPK signaling pathway - plant nsy04070   Phosphatidylinositol signaling system nsy04075   Plant hormone signal transduction nsy04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:nsy00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     104226402    04070 Phosphatidylinositol signaling system     104226402    04075 Plant hormone signal transduction     104226402  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     104226402  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nsy01009]     104226402   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nsy04131]     104226402    03036 Chromosome and associated proteins [BR:nsy03036]     104226402   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nsy04147]     104226402 Protein phosphatases and associated proteins [BR:nsy01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104226402 Membrane trafficking [BR:nsy04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104226402 Chromosome and associated proteins [BR:nsy03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104226402 Exosome [BR:nsy04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104226402 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 Caleosin EFhand_Ca_insen SPEF2_C SurA_N_3 FCaBP_EF-hand MotA_activ Poly_export Fe_hyd_lg_C DUF6279 MecA_N PhageMin_Tail Motif Other DBs NCBI-GeneID:  104226402 NCBI-ProteinID:  XP_009776698 UniProt:  A0A1U7WDG7 LinkDB All DBs Position 3:162125015..162128017 Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVRMMLAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagagcagctaacggaggagcagatcgctgagttcaaggaggcctttagccttttc gacaaggacggcgatggctgtattactaccaaggaattgggaacagtgatgagatcactt ggtcagaatcccactgaagctgaactacaggatatgatcagcgaggttgatgctgatcag aatggaaccattgattttccagagttcttgaatctgatggcacgtaagatgaaggacact gattctgaggaagaactcaaagaagctttcaaggttttcgataaagatcagaatggcttt atttctgcagctgagcttcgtcatgtaatgacaaaccttggagagaagctgactgatgaa gaggtggatgagatgatccgagaagcagatattgatggtgatgggcaagttaattacgag gagtttgtccgcatgatgcttgccaagtga

DBGET integrated database retrieval system