Nicotiana sylvestris (wood tobacco): 104231197 Help Entry 104231197         CDS       T05026                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism nsy  Nicotiana sylvestris (wood tobacco) Pathway nsy04145   Phagosome nsy04148   Efferocytosis nsy04620   Toll-like receptor signaling pathway nsy05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:nsy00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104231197    04148 Efferocytosis     104231197  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104231197  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     104231197  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nsy04131]     104231197   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nsy04147]     104231197    04031 GTP-binding proteins [BR:nsy04031]     104231197 Membrane trafficking [BR:nsy04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     104231197  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     104231197   Macropinocytosis    Ras GTPases     104231197  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     104231197 Exosome [BR:nsy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104231197   Exosomal proteins of other body fluids (saliva and urine)    104231197   Exosomal proteins of colorectal cancer cells    104231197   Exosomal proteins of bladder cancer cells    104231197 GTP-binding proteins [BR:nsy04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     104231197 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Sua5_C AAA_7 B12-binding Motif Other DBs NCBI-GeneID:  104231197 NCBI-ProteinID:  XP_009782450 UniProt:  A0A1U7X7J2 LinkDB All DBs Position 1:99919074..99923342 Genome browser AA seq 208 aa AA seqDB search MNTSSSASNNATATGTKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVN VDGKIVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSFENISKKWVPELRHYA PSVPIVLVGTKLDLREDKQFRRDYPGACTISTEQGEELKKQIGAVAYVECSAKTQQNVKA VFDTAIKVVLQPPKSKKQKGKHKTCWIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgaatactagtagtagtgccagtaataatgctactgcaacaggaacaaagttcatcaaa tgtgttactgttggagatggtgctgttggcaagacttgccttctcatctcctacactagc aacacctttcctactgattatgtgccaactgtttttgacaatttcagtgccaatgtcaat gttgatggaaagattgtgaatttgggtctctgggatactgctggtcaagaggattataac aggcttaggcctcttagttatcgaggagctgatgtcttcctgctcgcattctctctcata agtaggcctagctttgaaaatatatcaaaaaagtgggttcctgagctaagacattatgcc ccatcagtgcctattgttcttgtggggactaaattggatttaagagaggacaagcagttt agaagggactaccctggtgcatgtacaatttcaacagaacagggcgaagaactgaaaaag caaataggtgcagtggcatatgttgagtgcagcgccaagacacagcagaatgtgaaggct gttttcgatactgcaatcaaggtggttcttcagcctccaaagagcaaaaaacagaaagga aaacacaaaacctgctggatactttga

DBGET integrated database retrieval system