Nicotiana sylvestris (wood tobacco): 104234879 Help Entry 104234879         CDS       T05026                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism nsy  Nicotiana sylvestris (wood tobacco) Pathway nsy03083   Polycomb repressive complex nsy04120   Ubiquitin mediated proteolysis nsy04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nsy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104234879    04120 Ubiquitin mediated proteolysis     104234879   09126 Chromosome    03083 Polycomb repressive complex     104234879  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nsy04131]     104234879    04121 Ubiquitin system [BR:nsy04121]     104234879    03036 Chromosome and associated proteins [BR:nsy03036]     104234879 Membrane trafficking [BR:nsy04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104234879 Ubiquitin system [BR:nsy04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104234879    Cul7 complex      104234879 Chromosome and associated proteins [BR:nsy03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104234879   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104234879 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB DUF7667 Motif Other DBs NCBI-GeneID:  104234879 NCBI-ProteinID:  XP_009786816 UniProt:  A0A1U7XAY3 LinkDB All DBs Position 2:complement(28513416..28513911) Genome browser AA seq 151 aa AA seqDB search MSSKKLLVLKTSDGEEFELDEAVAVRSEAIKNMVEDDCASNTIPLPNVDSKTMAKVVEYW KKHSEKGVSGDELKDFDKNYVKVLNYTELYHLILAANYLNDKELLDILCQETADRIKGKT PEEIRKAFNIKNDFTPEEEEQIRQENAWAFA NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtcttccaaaaagctcttagtcttaaagacaagcgacggcgaggaattcgaactcgac gaggcagtggcggtgaggtcggaagccatcaaaaacatggtggaagatgattgtgcttca aataccatccccctacctaatgtcgacagcaaaacaatggccaaagtggtcgaatactgg aaaaaacactccgagaagggcgtctccggggacgagttgaaggattttgacaagaattat gtgaaggtgctgaattacacggagttgtatcatctaattttagctgctaattatcttaat gataaggagctattggatatattgtgtcaagaaactgctgataggatcaaagggaaaacg cccgaggaaatacgtaaagcatttaatatcaagaatgattttacccctgaagaagaggag caaatccgtcaagagaatgcttgggccttcgcttga

DBGET integrated database retrieval system