Nicotiana sylvestris (wood tobacco): 104236757 Help Entry 104236757         CDS       T05026                                  Name (RefSeq) calmodulin-7 isoform X1   KO K02183   calmodulin Organism nsy  Nicotiana sylvestris (wood tobacco) Pathway nsy04016   MAPK signaling pathway - plant nsy04070   Phosphatidylinositol signaling system nsy04075   Plant hormone signal transduction nsy04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:nsy00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     104236757    04070 Phosphatidylinositol signaling system     104236757    04075 Plant hormone signal transduction     104236757  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     104236757  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nsy01009]     104236757   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nsy04131]     104236757    03036 Chromosome and associated proteins [BR:nsy03036]     104236757   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nsy04147]     104236757 Protein phosphatases and associated proteins [BR:nsy01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104236757 Membrane trafficking [BR:nsy04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104236757 Chromosome and associated proteins [BR:nsy03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104236757 Exosome [BR:nsy04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104236757 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  104236757 NCBI-ProteinID:  XP_009789056 UniProt:  A0A1U7Y396 LinkDB All DBs Position 10:4060236..4063556 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagatcagctcacagatgatcagatctctgaattcaaagaagctttcagccttttc gataaggatggagatggttgcatcaccactaaggagcttgggacagtgatgcggtcattg ggacaaaatccaactgaggctgagcttcaagacatgatcaatgaagtagatgctgatgga aatggaaccattgatttcccggagttccttaacctgatggctcgcaagatgaaagacact gattctgaggaggagctcaaggaagctttcagagtgttcgacaaggatcagaacggattt atttctgcagccgagctgcgccatgtcatgacaaacctaggcgagaagcttactgatgaa gaagttgatgagatgattcgtgaagctgatgtggatggtgatggccagatcaactatgag gagttcgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system