KEGG   Caenibius tardaugens: EGO55_09595
Entry
EGO55_09595       CDS       T05741                                 
Name
(GenBank) ATP-binding cassette domain-containing protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
ntd  Caenibius tardaugens
Brite
KEGG Orthology (KO) [BR:ntd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ntd02000]
    EGO55_09595
Transporters [BR:ntd02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    EGO55_09595
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 ABC_ATPase AAA_16 AAA_22 AAA_29 AAA_30 Zeta_toxin AAA_23 ECH_2 RsgA_GTPase
Other DBs
NCBI-ProteinID: AZI36181
UniProt: U2YKB8
LinkDB
Position
2080173..2082044
AA seq 623 aa
MVSAQNPPSSSRRGLFARNRRHSDVAVPETDESGAVEPAAANNLGPLKMVWQAALGYPGK
LALAALALCITAAATLAIPSGFRLIIDRGFGSGGDAQDVGRWFQYLLVIVVVLAIGTALR
FYFVSWLGERVVADIRLKVQANLLRQAPGFFEENSPSEIASRMTADTTLIEQVVGTTVSV
ALRNLIIAIGGTAYLFVLLPRLAAGLLILIPLVVVPLRLFGRRLRSVSRTSQDRVADIGA
TISETLGAMKIVQAFNQEARESARFAGAVEQTFATARRRILIRAIMTAIIIVMVFGAITL
LMWRGAIGVAEGTITGGTIAAFVITGGLVAGAFGALTEVYGDLLRGAGAASRLSELLHTK
PEITAPARPQELPEPPRGGLAFQNVSFRYPTRLETAALRDFSLVVEPGETVAIVGPSGAG
KSTIFQLAERFYDPQSGTVRLDGVPLVSADPAEIRRRIAYVPQEGVLFAANARDNLRYGN
WAASDEDIWEAAHAANAEAFLKALPQGLDTFLGEGGARLSGGQRQRIAIARALLRDAPIL
LLDEATSALDAESERLVQQALERLMRDRTTLVIAHRLATVRAADRIVVMDGGQIVEQGRH
GELIAAGGLYARLASLQFQDNAA
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggtttccgcgcaaaacccgcccagttcttctcgccgtgggctgtttgcccgcaaccgg
cgccattccgacgtagccgttcccgaaacggatgaatccggcgcggtagagcctgcggct
gcaaacaatctcggccctctcaaaatggtgtggcaggcggcgctgggctatccgggcaag
ctcgcactggcggcgttggccctgtgtatcacggcggcggcgacactggcgatcccgtcc
ggttttcggctgattatcgatcgcggcttcggcagtggcggcgatgcacaggatgtcgga
cgctggtttcagtatttgctggtgattgtggtcgtgctggcgatcggcacggccttgcgg
ttctatttcgtgtcgtggctgggcgaacgggtggttgctgatatccggttgaaggtgcag
gccaacctcctgcgtcaggcgccgggtttcttcgaggaaaacagcccgagcgagatcgcc
tcgcgcatgacggcggacaccacgctgatcgaacaggtggtgggaaccacagtttcggtc
gccctgcgcaatctgattatagcgatcggcggcacagcctatctgttcgtgctcttgccc
agactggcggcggggctgttgatcctgattccgctggtggttgtgcccttgcgcctgttc
ggccgacgcctgcgatcggtgtcgcggaccagtcaggatcgggttgccgatatcggcgcc
accatatcggaaacgctgggggcgatgaagatcgtccaggccttcaatcaggaagcgcgg
gaaagcgcgcgctttgcaggcgcggtggaacagactttcgcgacggcccggcggcgcatc
ctgatccgcgcaatcatgaccgcgatcatcatcgttatggtgtttggcgcgatcacgctg
ctgatgtggcgcggcgcgatcggggttgccgaagggacgatcaccggcgggacaatcgcg
gcgttcgtgattaccggcgggctggtggccggggcgtttggcgccctgacggaagtgtat
ggcgatttgttgcgcggcgcgggggcggccagccggttgagcgaactgttgcacaccaaa
ccggaaatcaccgcgcctgcacgtccgcaggaactgcccgagccgccgcgcggcggactg
gcgttccagaatgtctcgttccgttatcccacccggctggaaactgccgcattgcgcgat
ttctcgctggtggtggagccgggggaaaccgttgctatcgtggggccgtcaggggcaggg
aaatccacgatcttccaactggcggagcgtttctacgatccccaatcgggtacggtgcgg
ctggacggtgtgccattggtcagcgccgatcccgccgaaatccgtcgtcggatcgcctat
gttccgcaggaaggtgtgttgtttgccgccaatgcgcgcgacaatctgcgttatggcaac
tgggcggcgagcgacgaggatatctgggaagcggcgcatgccgccaatgcggaagccttc
ctcaaggctctgccgcaggggctcgatactttccttggggaagggggcgcacggctctcc
ggtggccagcgccagcgtatcgccattgcccgcgccctgctgcgcgatgcgccgatcctg
ttgctggacgaagcgacaagcgcgctggacgcggaaagcgaacggttggtgcagcaggcg
ctcgaacggctcatgcgtgatcgtaccacgctggtcatcgcccatcgcctggccacagtg
cgcgcggcggaccggatcgtggtgatggatggcgggcagattgtcgaacagggccgccat
ggcgaactgatcgcggcgggcgggctttacgcgcgtctggccagcctgcagtttcaggat
aatgccgcgtga

DBGET integrated database retrieval system