Natranaerobius thermophilus: Nther_1349
Help
Entry
Nther_1349 CDS
T00761
Name
(GenBank) Phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
nth
Natranaerobius thermophilus
Pathway
nth00770
Pantothenate and CoA biosynthesis
nth01100
Metabolic pathways
nth01240
Biosynthesis of cofactors
Module
nth_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
nth00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
Nther_1349
Enzymes [BR:
nth01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
Nther_1349
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
OSCP
Motif
Other DBs
NCBI-ProteinID:
ACB84932
UniProt:
B2A2L7
LinkDB
All DBs
Position
1422211..1422699
Genome browser
AA seq
162 aa
AA seq
DB search
MKTVIYPGSFDPPTNGHLDIIQRAARVFDKVIVAVLNNPEKNPMFTVAERRKMLEMITKE
YANVEIDDFNGLLVDYVREKQVSIVIKGLRAISDFENEMQMALTNRKLAPDIETIFMMTN
HKCSFLSSSVVKEVVAFDGCIEGLVPEQIQDYIIEKRNSQRK
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgaaaacggtaatttatcccggaagttttgatccaccaacaaatggccatttggatatt
attcaaagagctgctcgggtttttgataaagttatagttgctgtgttaaataatccagag
aaaaaccctatgtttacagtggcagaacgtcgaaaaatgttggaaatgatcactaaggaa
tatgccaatgtagaaattgatgattttaatgggttactagttgattatgttagagaaaaa
caagttagcatagttattaaaggtcttcgagctatatcggattttgaaaatgaaatgcaa
atggctctgacgaatagaaaattagcacctgatattgaaactattttcatgatgactaat
cataaatgttcatttttaagttccagtgtagtaaaagaagtagtagcttttgatggatgt
attgagggattagtaccagaacaaattcaagactacattattgaaaaaaggaactctcaa
aggaaatga
DBGET
integrated database retrieval system