Nitrospira tepida: DNFV4_04318 Help Entry DNFV4_04318       CDS       T09383                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism nti  Nitrospira tepida Pathway nti00998   Biosynthesis of various antibiotics nti01100   Metabolic pathways nti01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nti00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DNFV4_04318    00074 Mycolic acid biosynthesis     DNFV4_04318   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DNFV4_04318 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding MS_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  CAI4033876 UniProt:  A0AA86N3I0 LinkDB All DBs Position NsDNF:4403594..4403842 Genome browser AA seq 82 aa AA seqDB search MTTPATDIRETIIRLLGEIAPEADMASLRSDLNLRDQLDIDSMDFLNFVIALHKTFEIEI PETDYPRLSTLDGCVAYVAERR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacgacgccggccacggacatacgggagacgatcatccgattgctcggcgagattgcc ccggaggcggacatggcgtcgcttcggtccgacctaaaccttcgcgaccaattggacatc gattccatggattttctgaacttcgtgatcgcgctgcacaagacgttcgagatcgagatc ccggaaaccgattatccccgtctctccaccctggacggttgcgtcgcctacgtcgcggag cgccggtga

DBGET integrated database retrieval system