KEGG   Neobacillus thermocopriae: BTDUT50_04940
Entry
BTDUT50_04940     CDS       T06692                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
ntm  Neobacillus thermocopriae
Brite
KEGG Orthology (KO) [BR:ntm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ntm03000]
    BTDUT50_04940
Transcription factors [BR:ntm03000]
 Prokaryotic type
  Other transcription factors
   Others
    BTDUT50_04940
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: QAV27814
UniProt: A0A410XM77
LinkDB
Position
931723..932676
AA seq 317 aa
MWRYTYLIFALLVILSSCAPAQLSSGHVQKVGLLVSDTIDDQVWGTKGYKGLLRIQAKFG
ADVFYREGVNSKAATAHAVKQFHEKGVTLIFGHGSEYGQYFHDLADKYPDIHFVFFNGEA
KKKNVTSFNFQGHAMGFFGGMVAGHMTKTNNIGVIAAFEWQPEVDGFFEGALYENENAHV
DVEYVQNWDDINTALAIAERMIADGVDVIYPAGDKFSVPIIEKMKEYGLYAIGYVTDQSD
LGERTVLTSTVQHVDELYELVTKKFIDGKLKAGTTYVDFQDGVIELGTFSPLVEESFQQK
IKKAITRYKATGKLPNE
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtggcgatatacatatttgatttttgcactacttgttatattatcttcttgcgctcct
gctcaattatcatcgggacatgtacaaaaggttggtttgctcgtttcggatacgatcgac
gatcaagtgtggggaacgaaaggatataaagggttgcttcgtattcaagcgaagtttgga
gcggacgtgttttatcgcgaaggggtcaactcgaaggccgctacggcacatgcggtaaaa
caattccacgaaaaaggtgtcacattaattttcggacacgggagcgagtatggacaatat
tttcatgatcttgcggacaaatatccagatattcattttgtattttttaacggagaggcg
aaaaagaaaaacgtcacaagcttcaatttccaaggacatgcgatgggcttttttggaggc
atggtcgcaggacatatgacgaaaacgaataacattggcgtgattgccgcatttgaatgg
cagccggaagtggacggttttttcgaaggagcgttatatgaaaacgaaaatgcccatgtc
gacgttgaatatgtgcaaaattgggatgacataaatacagctctggcgattgctgagcgg
atgatcgcagatggcgtagatgtcatatatcccgctggcgataaatttagcgtgccgatt
attgaaaaaatgaaagaatatgggctttatgcgatcggatatgtaacagaccaatcagat
ttaggggaacgaacagtgctgacaagcaccgtccaacatgtcgacgaactgtacgaactc
gttacgaaaaaatttatagatggaaagttaaaagctgggacgacatatgtcgactttcaa
gacggtgtcatcgaactcggcacgtttagcccacttgtcgaggaatcgtttcagcaaaaa
ataaaaaaagcgattacgcgatataaagcaacgggaaaattgccgaatgagtaa

DBGET integrated database retrieval system