Neobacillus thermocopriae: BTDUT50_08425 Help Entry BTDUT50_08425     CDS       T06692                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism ntm  Neobacillus thermocopriae Pathway ntm02024   Quorum sensing ntm03018   RNA degradation Brite KEGG Orthology (KO) [BR:ntm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BTDUT50_08425  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BTDUT50_08425  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ntm03019]     BTDUT50_08425    03036 Chromosome and associated proteins [BR:ntm03036]     BTDUT50_08425 Messenger RNA biogenesis [BR:ntm03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BTDUT50_08425 Chromosome and associated proteins [BR:ntm03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BTDUT50_08425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 DUF5608 Motif Other DBs NCBI-ProteinID:  QAV26658 LinkDB All DBs Position 1602571..1602795 Genome browser AA seq 74 aa AA seqDB search MKNTINIQDQFLNQLRKEETTVTVFLLNGFQLRGLVKGFDNFTVLLEVDGKQQLIYKHAI STFAPQKNVKIEIE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaaaaacacgataaacattcaagatcagtttttaaaccaattgcggaaggaagaaaca acggttactgtatttttgctaaatggatttcaattgcgtgggttagtgaaaggatttgac aatttcacagtattgttagaagtggatggaaaacaacaattaatttataaacatgccatt tccacatttgcaccacaaaaaaacgtaaaaattgagattgagtaa

DBGET integrated database retrieval system