Neobacillus thermocopriae: BTDUT50_08860
Help
Entry
BTDUT50_08860 CDS
T06692
Name
(GenBank) transporter
KO
K02598
nitrite transporter
Organism
ntm
Neobacillus thermocopriae
Brite
KEGG Orthology (KO) [BR:
ntm00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ntm02000
]
BTDUT50_08860
Transporters [BR:
ntm02000
]
Other transporters
Pores ion channels [TC:
1
]
BTDUT50_08860
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Form_Nir_trans
TgpA_N
T4SS_pilin
Motif
Other DBs
NCBI-ProteinID:
QAV26736
LinkDB
All DBs
Position
1679678..1680496
Genome browser
AA seq
272 aa
AA seq
DB search
MEALQTCKELALKKRSILQTSPLQYMIRAALAGVYIGFALVLCVRIGQYFYEAHSPVTYL
VSGIFFGIALVLIMYGGAELFTGNTMYFTVSTLQKETTIGDTLRNWVACYSGNLLGAIFF
AFLIAQSGIFHDIPMDHLLFAIALKKMHATTIQLFVKGILCNWLVCLAIFIPMQMKEDMA
KMFAMILIVFVFFASGYEHSIANFVIFSLALAVEHPDTIHVAGIIHNIVPVTLGNIVGGS
LFMGALYTYLSSNKQSTPAWKGAFGVRKILNK
NT seq
819 nt
NT seq
+upstream
nt +downstream
nt
atggaagctttacaaacatgtaaagagcttgcattaaagaagcgctccattttgcaaaca
tcgcctcttcaatacatgattcgtgctgcgttggcaggtgtatacattggttttgctctc
gttctttgcgtacgtatcggacaatacttttatgaggcgcattcacctgtaacgtattta
gtgagcggtattttcttcggaattgcccttgtgttgattatgtatggcggtgcagaacta
tttacagggaatacgatgtactttactgtaagtacgcttcaaaaagaaacgacgattggt
gacacgcttcgtaactgggtggcgtgttatagcggcaacttgcttggtgcgattttcttc
gcctttttgattgcacagtcaggtatttttcatgacattccgatggatcatttacttttt
gcaattgctttgaaaaaaatgcacgcaacaacgatacaattgtttgtcaaagggatttta
tgtaactggcttgtttgtttagctatttttattccaatgcaaatgaaagaagatatggca
aaaatgtttgcgatgattttaatcgttttcgtcttttttgcttccggatatgaacactct
attgcaaactttgttattttttcacttgctttagctgtcgagcatccagatacaattcat
gtagcggggattatccataacatcgtacctgtaacgcttgggaatatcgttggtggctca
ttatttatgggggcgttatacacatatctttcatctaataaacaatctacgcctgcgtgg
aaaggggcgtttggagtaagaaaaatattgaacaaataa
DBGET
integrated database retrieval system