Neokomagataea tanensis: D5366_07400 Help Entry D5366_07400       CDS       T06079                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ntn  Neokomagataea tanensis Pathway ntn01100   Metabolic pathways ntn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ntn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D5366_07400    00074 Mycolic acid biosynthesis     D5366_07400   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D5366_07400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QDH25063 UniProt:  A0A4Y6V560 LinkDB All DBs Position complement(1603198..1603443) Genome browser AA seq 81 aa AA seqDB search MTDNVSSISQMIIEKLLANPKVPRDITGSSKIVEDLAFDSLAVMNFVMEIEDELDVSVPL DKLADIRTIDDLATCLNGLKG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccgataacgtatccagcatttcccagatgatcatcgaaaaactgctcgctaaccct aaagtcccccgcgacatcacaggcagcagcaaaattgttgaagatctggcttttgacagc ctggcggtcatgaactttgtaatggaaattgaagacgagctcgacgtttccgttccgctc gacaagcttgcggatattcgcactattgatgatctggcaacctgcctaaatgggctgaag ggctaa

DBGET integrated database retrieval system