Nicotiana tomentosiformis: 104087409 Help Entry 104087409         CDS       T05025                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism nto  Nicotiana tomentosiformis Pathway nto04145   Phagocytosis nto04517   IgSF CAM signaling nto04814   Motor proteins Brite KEGG Orthology (KO) [BR:nto00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     104087409  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     104087409   09142 Cell motility    04814 Motor proteins     104087409  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:nto03037]     104087409    04812 Cytoskeleton proteins [BR:nto04812]     104087409 Cilium and associated proteins [BR:nto03037]  Motile cilia and associated proteins   Dynein arm    104087409 Cytoskeleton proteins [BR:nto04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      104087409 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  104087409 NCBI-ProteinID:  XP_009590153 LinkDB All DBs Position 7:complement(44990203..44994577) Genome browser AA seq 114 aa AA seqDB search MLEGKAVIGDTDMLATMQRDALDLAAKALDFFDVTEATEIARYLKKEFDTTYGPGWQCIV GTDFGSFVTHCYGCFIHFYIGSLAILLFKGSAAPEDTKAEAAEVDRFSALQEIA NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgctggaaggcaaggcagtaattggagacacagacatgctcgcaaccatgcaacgagat gccttagatttagctgcaaaggctcttgattttttcgatgtcactgaggccactgaaatt gcccgctaccttaaaaaggaatttgatacgacgtatggaccgggatggcaatgcatagta gggacagactttggttcatttgtaactcattgctatggctgtttcatccatttttacatt ggcagccttgccattttgctcttcaaaggctcagctgctccggaggacaccaaagctgag gctgctgaggttgaccgattttccgctctgcaggaaatagcgtaa

DBGET integrated database retrieval system