Nicotiana tomentosiformis: 104096122 Help Entry 104096122         CDS       T05025                                  Name (RefSeq) SKP1-like protein 5   KO K03094   S-phase kinase-associated protein 1 Organism nto  Nicotiana tomentosiformis Pathway nto03083   Polycomb repressive complex nto04120   Ubiquitin mediated proteolysis nto04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nto00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104096122    04120 Ubiquitin mediated proteolysis     104096122   09126 Chromosome    03083 Polycomb repressive complex     104096122  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nto04131]     104096122    04121 Ubiquitin system [BR:nto04121]     104096122    03036 Chromosome and associated proteins [BR:nto03036]     104096122 Membrane trafficking [BR:nto04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104096122 Ubiquitin system [BR:nto04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104096122    Cul7 complex      104096122 Chromosome and associated proteins [BR:nto03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104096122   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104096122 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 DUF1221 Motif Other DBs NCBI-GeneID:  104096122 NCBI-ProteinID:  XP_009600728 LinkDB All DBs Position 5:complement(25390830..25391219) Genome browser AA seq 129 aa AA seqDB search MFSSKASFLVKIIEYLKKHAEIKGSDEEEIKKTKIKDFDKEFVSVKMQKLFNIILVANFL DIKPLLDLCAQAIADKIKNKSHVVVRQNFNVQCDYTREEEDVVRKENEWGIINFSPRQKL FISGSRKSV NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgttttcatctaaggcatccttcctagtcaagatcatcgagtacctcaagaagcatgca gaaatcaagggttcagacgaagaagaaatcaagaaaaccaaaatcaaggacttcgataag gaattcgttagcgttaagatgcaaaaactcttcaatatcatattggttgcaaatttcctt gacattaagcctttgctcgatctttgtgctcaggctattgctgacaagatcaagaacaag tcgcatgtggttgttcgacaaaatttcaatgttcaatgtgattatactcgagaggaagaa gatgtcgttcggaaagaaaatgaatggggtattatcaattttagcccgcgccagaaatta tttatatctggtagccgaaaaagtgtataa

DBGET integrated database retrieval system