Nicotiana tomentosiformis: 104096127 Help Entry 104096127         CDS       T05025                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism nto  Nicotiana tomentosiformis Pathway nto03083   Polycomb repressive complex nto04120   Ubiquitin mediated proteolysis nto04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nto00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104096127    04120 Ubiquitin mediated proteolysis     104096127   09126 Chromosome    03083 Polycomb repressive complex     104096127  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nto04131]     104096127    04121 Ubiquitin system [BR:nto04121]     104096127    03036 Chromosome and associated proteins [BR:nto03036]     104096127 Membrane trafficking [BR:nto04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104096127 Ubiquitin system [BR:nto04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104096127    Cul7 complex      104096127 Chromosome and associated proteins [BR:nto03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104096127   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104096127 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 KwaB DUF3010 AROS UxuA FadA ArgoMid Motif Other DBs NCBI-GeneID:  104096127 NCBI-ProteinID:  XP_009600732 LinkDB All DBs Position 5:25557564..25558022 Genome browser AA seq 137 aa AA seqDB search MLTLKSGDNEEFYVEESLVLQSDLIKTMVKEDRVSTIPLPSFKSKTLVKIIEYLKKHAEL TTTSNNEDFKNFQKEFVNVVKEFDITVAAVADRIKDKSVEAVQKIFKIESDFTSEELAEF KRETPWAFEGDLDDTTN NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgttgacattgaagagcggtgataacgaagaattttatgttgaggaatctttggtctta cagtctgatcttatcaaaaccatggtaaaagaggatcgtgtttccaccatcccattgcca agcttcaaaagcaagacgctggttaaaatcattgaatacctcaagaaacatgcagagctc actactacctcgaacaatgaagatttcaagaatttccagaaagagtttgtgaatgttgtg aaagagtttgacataaccgtggcagctgtggctgacagaataaaggacaagagcgttgaa gccgttcagaagatttttaaaattgaaagtgatttcacctcagaagaactggccgagttt aaaagggaaactccttgggcctttgaaggtgaccttgatgataccaccaactag

DBGET integrated database retrieval system