Nicotiana tomentosiformis: 104101503 Help Entry 104101503         CDS       T05025                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism nto  Nicotiana tomentosiformis Pathway nto03083   Polycomb repressive complex nto04120   Ubiquitin mediated proteolysis nto04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:nto00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104101503    04120 Ubiquitin mediated proteolysis     104101503   09126 Chromosome    03083 Polycomb repressive complex     104101503  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nto04131]     104101503    04121 Ubiquitin system [BR:nto04121]     104101503    03036 Chromosome and associated proteins [BR:nto03036]     104101503 Membrane trafficking [BR:nto04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104101503 Ubiquitin system [BR:nto04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104101503    Cul7 complex      104101503 Chromosome and associated proteins [BR:nto03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104101503   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104101503 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ DUF1221 Motif Other DBs NCBI-GeneID:  104101503 NCBI-ProteinID:  XP_018628049 LinkDB All DBs Position 5:complement(25587009..25587554) Genome browser AA seq 121 aa AA seqDB search MVEDDCASNIIPLPNVDIETLVKIIEYLKKHAEISGSDEEEEIKKTKIKDFDKEFVSIKM QKLFNIIVAANFLDIKALLDLCAQAIADKIKNKSHVAVRKIFNVQCDYTQEEEDAVRKEN E NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggtagaagatgattgtgcatccaacatcataccactacccaacgttgacattgaaacc ctagtcaagatcatcgagtacctcaagaagcatgcagaaatctcgggttcagacgaagaa gaagaaatcaagaaaaccaaaatcaaggacttcgataaggaattcgttagcattaagatg caaaaactcttcaatatcatagtggctgcgaatttcctagacattaaggctttgctcgat ctttgcgctcaggctattgctgataagatcaagaacaagtcgcatgtggctgttcgaaaa attttcaatgttcaatgtgattatactcaagaggaagaagatgccgttcggaaagaaaat gaatag

DBGET integrated database retrieval system